Property Summary

NCBI Gene PubMed Count 32
PubMed Score 49.11
PubTator Score 25.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma 1.700 2.1e-02
Breast cancer 1.300 3.2e-04
gastric carcinoma 1.600 1.3e-02
group 4 medulloblastoma -1.300 3.0e-02
head and neck cancer -1.200 1.3e-02
interstitial cystitis 1.900 1.6e-03
invasive ductal carcinoma 1.804 1.3e-04
juvenile dermatomyositis 1.213 1.1e-10
lung cancer -1.100 1.9e-04
lung carcinoma -1.300 7.7e-27
non-small cell lung cancer -1.047 7.7e-09
osteosarcoma -2.135 3.4e-03
ovarian cancer 1.600 2.4e-03
primary Sjogren syndrome 2.200 4.4e-04
subependymal giant cell astrocytoma 2.344 1.6e-02
ulcerative colitis 1.500 1.2e-04

Gene RIF (16)

AA Sequence

MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIIAFSQGDPSRHQAILGMAF      1 - 70
LVLAVFAALSVLMYVECLLRRWLRALALLTWACLVALGYVLVFDAWTKAACAWEQVPFFLFIVFVVYTLL     71 - 140
PFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVRVGLQLLANAVIFLCGNLTGAFHKHQMQDASRDLFT    141 - 210
YTVKCIQIRRKLRIEKRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSI    211 - 280
LYADIVGFTQLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKM    281 - 350
GLDMCQAIKQVREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT    351 - 420
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRASVRMTRYLES    421 - 490
WGAARPFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRSEDDSYDDEMLSAIEGLSSTR    491 - 560
PCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACASLIFVCILLVHVLLMPRTAALGVSFGLVAC    561 - 630
VLGLVLGLCFATKFSRCCPARGTLCTISERVETQPLLRLTLAVLTIGSLLTVAIINLPLMPFQVPELPVG    631 - 700
NETGLLAASSKTRALCEPLPYYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCC    701 - 770
GQGLGNLTKPNGTTSGTPSCSWKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFET    771 - 840
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKEGLECLRLLNE    841 - 910
IIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAHIGVMVEFSIALMSKLDGINR    911 - 980
HSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCEC    981 - 1050
RGLINVKGKGELRTYFVCTDTAKFQGLGLN                                           1051 - 1080
//

Text Mined References (32)

PMID Year Title