Property Summary

NCBI Gene PubMed Count 31
Grant Count 27
R01 Count 18
Funding $3,675,687.5
PubMed Score 47.16
PubTator Score 25.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
osteosarcoma -2.135 0.003
astrocytoma 1.700 0.021
juvenile dermatomyositis 1.213 0.000
non-small cell lung cancer -1.047 0.000
lung cancer -1.100 0.000
interstitial cystitis 1.900 0.002
group 4 medulloblastoma -1.300 0.030
primary Sjogren syndrome 2.200 0.000
subependymal giant cell astrocytoma 2.344 0.016
invasive ductal carcinoma 1.804 0.000
lung carcinoma -1.300 0.000
gastric carcinoma 1.600 0.013
ulcerative colitis 1.500 0.000
ovarian cancer 1.600 0.002
Breast cancer 1.300 0.000
head and neck cancer -1.200 0.013

Gene RIF (15)

PMID Text
26220344 The ADCY7 deficiency resulted in decreased cell growth, elevated apoptosis, and lower c-Myc expression in cultured leukemia cells obtained from acute myeloid leukemia patients.
25959651 The stronger TNF-alpha responses in young males compared to females may be partly associated with male-specific down-regulation of ADCY7 and ADCY9.
22264442 evidence implicates ADCY7 in the modulation of mood regulatory neural mechanisms and, possibly, risk for and pathophysiology of depression.
21481845 we found that single nucleotide polymorphisms in ADCY7 associate with alcohol dependence in women, and these markers are also associated with ADCY7 expression (messenger RNA) levels.
19874574 Observational study of gene-disease association. (HuGE Navigator)
19008230 soluble adenylyl cyclase is responsive to both CO(2) and bicarbonate ion
18541530 AC7 is a specific downstream effector of the G(12/13) pathway
17135423 Brain type VII adenylyl cyclase isoform plays a sex-specific role in the manifestation of a heritable form of depressive symptoms in genetically modified mice.
15581358 The first cytoplasmic domain (residues 506-584) of adenylyl cyclase (AC) type VII is an internal regulatory subunit, interacting with a cardinal activator of AC (Gs alpha) and with the conserved first catalytic domain of type VII AC.
11884542 The addition of HIV-1 gp120 with TNF-alpha to human B-cells stimulates cAMP production in a dose-dependent manner
More...

AA Sequence

MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIIAFSQGDPSRHQAILGMAF      1 - 70
LVLAVFAALSVLMYVECLLRRWLRALALLTWACLVALGYVLVFDAWTKAACAWEQVPFFLFIVFVVYTLL     71 - 140
PFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVRVGLQLLANAVIFLCGNLTGAFHKHQMQDASRDLFT    141 - 210
YTVKCIQIRRKLRIEKRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSI    211 - 280
LYADIVGFTQLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKM    281 - 350
GLDMCQAIKQVREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT    351 - 420
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRASVRMTRYLES    421 - 490
WGAARPFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRSEDDSYDDEMLSAIEGLSSTR    491 - 560
PCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACASLIFVCILLVHVLLMPRTAALGVSFGLVAC    561 - 630
VLGLVLGLCFATKFSRCCPARGTLCTISERVETQPLLRLTLAVLTIGSLLTVAIINLPLMPFQVPELPVG    631 - 700
NETGLLAASSKTRALCEPLPYYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCC    701 - 770
GQGLGNLTKPNGTTSGTPSCSWKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFET    771 - 840
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKEGLECLRLLNE    841 - 910
IIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAHIGVMVEFSIALMSKLDGINR    911 - 980
HSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCEC    981 - 1050
RGLINVKGKGELRTYFVCTDTAKFQGLGLN                                           1051 - 1080
//

Text Mined References (31)

PMID Year Title
26220344 2015 ADCY7 supports development of acute myeloid leukemia.
25959651 2015 Higher TNF? responses in young males compared to females are associated with attenuation of monocyte adenylyl cyclase expression.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22264442 2012 Adenylate cyclase 7 is implicated in the biology of depression and modulation of affective neural circuitry.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21481845 2011 Sex-specific role for adenylyl cyclase type 7 in alcohol dependence.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19008230 2009 Stimulation of mammalian G-protein-responsive adenylyl cyclases by carbon dioxide.
18541530 2008 Regulation of cAMP responses by the G12/13 pathway converges on adenylyl cyclase VII.
17760784 2007 Isoform-specific enhancement of adenylyl cyclase activity by n-alkanols.
More...