Property Summary

NCBI Gene PubMed Count 31
PubMed Score 24.92
PubTator Score 18.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P51826 B7ZM46 B9EGL9 D3DVI6 Q53RD6 Q53S47 Q53SI6 Q53TB9 Q59F27 Q8IWJ5
Symbols LAF4
MLLT2-like

Gene

PANTHER Protein Class (1)

 GO Function (1)

Gene RIF (16)

PMID Text
25819087 Both the AFF3 and NTM triglyceride associations were replicated among Multi-ethnic Study of Atherosclerosis study participants (P = 1.00 x 10(-7) and 8.00 x 10(-5), respectively).
24763282 FRA2A-expressing individuals have mosaic expansions of the AFF3 CGG repeat.
22983539 Significant evidence for association of AFF3 rs10865035 with systgemic lupus erythmatgosus was detected.
21330300 overexpression of AFF2/3/4 interferes with the organization and/or biogenesis of nuclear speckles.
20498205 Meta-analysis of gene-disease association. (HuGE Navigator)
20444755 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20219786 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20072139 Observational study of gene-disease association. (HuGE Navigator)
19359276 AFF3 is a novel rheumatoid arthritis susceptibile gene.
More...

AA Sequence

MDSFDLALLQEWDLESLCVYEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQ      1 - 70
NTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQTPVNKIDEHFVADSRAQNQPSSICSTTTSTPAAVPVQQ     71 - 140
SKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQPRAKQVCNVEVGLQTQERPPAMAAKHSSSG    141 - 210
HCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSSETSVHCTSYRGVPASKPEPARAKAK    211 - 280
LSKFSIPKQGEESRSGETNSCVEEIIREMTWLPPLSAIQAPGKVEPTKFPFPNKDSQLVSSGHNNPKKGD    281 - 350
AEPESPDSGTSNTSMLEDDLKLSSDEEENEQQAAQRTALRALSDSAVVQQPNCRTSVPSSKGSSSSSSSG    351 - 420
SSSSSSDSESSSGSDSETESSSSESEGSKPPHFSSPEAEPASSNKWQLDKWLNKVNPHKPPILIQNESHG    421 - 490
SESNQYYNPVKEDVQDCGKVPDVCQPSLREKEIKSTCKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVSA    491 - 560
AAPPPAVPCAPAENAPAPARRSAGKKPTRRTERTSAGDGANCHRPEEPAAADALGTSVVVPPEPTKTRPC    561 - 630
GNNRASHRKELRSSVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQEEYPLSKAQTVAASA    631 - 700
SSGNDQRLKEAAANGGSGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNELLSPLKDSDEIRSLWVKI    701 - 770
DLTLLSRIPEHLPQEPGVLSAPATKDSESAPPSHTSDTPAEKALPKSKRKRKCDNEDDYREIKKSQGEKD    771 - 840
SSSRLATSTSNTLSANHCNMNINSVAIPINKNEKMLRSPISPLSDASKHKYTSEDLTSSSRPNGNSLFTS    841 - 910
ASSSKKPKADSQLQPHGGDLTKAAHNNSENIPLHKSRPQTKPWSPGSNGHRDCKRQKLVFDDMPRSADYF    911 - 980
MQEAKRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSG    981 - 1050
PNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKSTGTPSPM   1051 - 1120
SPNPSPASSVGSQGSLSNASALSPSTIVSIPQRIHQMAANHVSITNSILHSYDYWEMADNLAKENREFFN   1121 - 1190
DLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAHLS                                     1191 - 1226
//

Text Mined References (33)

PMID Year Title
25819087 2015 Genome-wide linkage and positional association analyses identify associations of novel AFF3 and NTM genes with triglycerides: the GenSalt study.
25353672 2015 Genome wide association study identifies a novel putative mammographic density locus at 1q12-q21.
24782177 2014 Novel risk loci for rheumatoid arthritis in Han Chinese and congruence with risk variants in Europeans.
24763282 2014 FRA2A is a CGG repeat expansion associated with silencing of AFF3.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23028342 2012 New susceptibility loci associated with kidney disease in type 1 diabetes.
22983539 2012 Association of AFF1 rs340630 and AFF3 rs10865035 polymorphisms with systemic lupus erythematosus in a Chinese population.
21330300 2011 Functional characterization of the AFF (AF4/FMR2) family of RNA-binding proteins: insights into the molecular pathology of FRAXE intellectual disability.
20498205 2010 Investigation of potential non-HLA rheumatoid arthritis susceptibility loci in a European cohort increases the evidence for nine markers.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
More...