Property Summary

NCBI Gene PubMed Count 57
PubMed Score 403.10
PubTator Score 127.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.500 5.6e-03
chronic lymphosyte leukemia -1.200 2.8e-04
dermatomyositis 1.300 3.0e-04
lung adenocarcinoma -1.200 1.1e-12
lung cancer -1.100 1.2e-03
medulloblastoma, large-cell 1.300 1.2e-05
Multiple myeloma 1.089 2.1e-02
Multiple Sclerosis 1.100 1.5e-03
osteosarcoma -1.426 1.5e-04
ovarian cancer -2.500 1.2e-10
psoriasis -1.500 7.1e-05
sonic hedgehog group medulloblastoma 1.200 2.1e-04
subependymal giant cell astrocytoma 1.472 4.2e-03
ulcerative colitis -1.026 9.8e-03
Waldenstrons macroglobulinemia 1.374 1.0e-02

Gene RIF (43)

AA Sequence

MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEF      1 - 70
LSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRT     71 - 140
EPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPP    141 - 210
LSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPPSQTFPPPSLP    211 - 280
SKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYS    281 - 350
NEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTS    351 - 420
SMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSS    421 - 490
DSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESK    491 - 560
DPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLL    561 - 630
PYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEH    631 - 700
FALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLL    701 - 770
SRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSS    771 - 840
SSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDS    841 - 910
SIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAEL    911 - 980
MTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVL    981 - 1050
CMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSA   1051 - 1120
GSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNSSLV   1121 - 1190
DLVHYTRQGFQQLQELTKTP                                                     1191 - 1210
//

Text Mined References (69)

PMID Year Title