Property Summary

NCBI Gene PubMed Count 52
PubMed Score 370.00
PubTator Score 127.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung adenocarcinoma 2714 1.08473995080173E-12
ovarian cancer 8492 1.2308124350719E-10
psoriasis 6685 4.30689703595678E-6
medulloblastoma, large-cell 6234 1.1670531738044E-5
osteosarcoma 7933 1.51274794056288E-4
sonic hedgehog group medulloblastoma 1482 2.06524751615126E-4
chronic lymphosyte leukemia 232 2.75174848072731E-4
dermatomyositis 967 3.02154141531483E-4
Multiple Sclerosis 498 0.0014975774710786
subependymal giant cell astrocytoma 2287 0.00418791525884026
astrocytoma 1493 0.00557559140339728
lung cancer 4473 0.00594597483951424
ulcerative colitis 2087 0.00980099909042222
Waldenstrons macroglobulinemia 765 0.010209426226081
Multiple myeloma 1328 0.0207731355983669
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 88 5.842 2.9

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.374 0.010
Multiple myeloma 1.089 0.021
psoriasis -3.600 0.000
osteosarcoma -1.426 0.000
chronic lymphosyte leukemia -1.200 0.000
astrocytoma 1.500 0.006
medulloblastoma, large-cell 1.300 0.000
ulcerative colitis -1.026 0.010
lung cancer -1.600 0.006
Multiple Sclerosis 1.100 0.001
sonic hedgehog group medulloblastoma 1.200 0.000
subependymal giant cell astrocytoma 1.472 0.004
lung adenocarcinoma -1.200 0.000
ovarian cancer -2.500 0.000
dermatomyositis 1.300 0.000

Synonym

Accession P51825 B4DTU1 E9PBM3
Symbols AF4
PBM1
MLLT2

Gene

PANTHER Protein Class (1)

PDB

2LM0  

  Ortholog (11)

Gene RIF (38)

PMID Text
26593443 AF4 bindsto SL1 to initiate MLL fusion- and AEP-dependent transcription.
26329759 AF4 and AF4-MLL mediate transcriptional elongation of 5-lipoxygenase mRNA by 1, 25-dihydroxyvitamin D3.
26007649 HIV-1 Tat transactivation is mediated by the AFF1- super elongation complex and does so more than the AFF4-super elongation complex due to a single amino acid that causes enhancement of Tat for cyclin T1
24843025 HIV-1 Tat transactivation is mediated by the AFF1- super elongation complex and does so more than the AFF4-super elongation complex due to a single amino acid that causes enhancement of Tat for cyclin T1
24565118 HIV-1 Tat transactivation is mediated by the AFF1- super elongation complex and does so more than the AFF4-super elongation complex due to a single amino acid that causes enhancement of Tat for cyclin T1
24367103 AFF1 is a ubiquitous P-TEFb partner; full Tat transactivation requires the complete super elongation complexes
24367103 HIV-1 Tat transactivation is mediated by the AFF1- super elongation complex and does so more than the AFF4-super elongation complex due to a single amino acid that causes enhancement of Tat for cyclin T1
24189350 Report generation of MLL/AF4 transgenic mice with the phenotype of lymphoblastic leukemia or lymphoma.
23518577 HIV-1 Tat transactivation is mediated by the AFF1- super elongation complex and does so more than the AFF4-super elongation complex due to a single amino acid that causes enhancement of Tat for cyclin T1
23479570 The FLT3-mediated inhibition of hematopoiesis in MLL-AF4-expressing human embryonic stem cells is associated with large transcriptional changes and downregulation of genes involved in hematopoietic system development and function.
More...

AA Sequence

MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNMLGNYEEVKEF      1 - 70
LSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRT     71 - 140
EPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRRADGDHCASVTDSAPERELSPLISLPSPVPP    141 - 210
LSPIHSNQQTLPRTQGSSKVHGSSNNSKGYCPAKSPKDLAVKVHDKETPQDSLVAPAQPPSQTFPPPSLP    211 - 280
SKSVAMQQKPTAYVRPMDGQDQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYS    281 - 350
NEVHCVEEILKEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTS    351 - 420
SMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSSSDSESESSSS    421 - 490
DSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRRHPESKGSSDSATSQEHSESK    491 - 560
DPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTVGTKQPKKPVKASARAGSRTSLQGEREPGLL    561 - 630
PYGSRDQTSKDKPKVKTKGRPRAAASNEPKPAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEH    631 - 700
FALVPLTESQGPPHSGSGSRTSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLL    701 - 770
SRIPQPPGKGSRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSS    771 - 840
SSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSASSTKSNHKDS    841 - 910
SIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFDKQQADLHMREAKKMKQKAEL    911 - 980
MTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYSETVDLIKFIMSLKSFSDATAPTQEKIFAVL    981 - 1050
CMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSA   1051 - 1120
GSVGSSGVAATISTPVTIQNMTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNSSLV   1121 - 1190
DLVHYTRQGFQQLQELTKTP                                                     1191 - 1210
//

Text Mined References (64)

PMID Year Title
26593443 2015 AF4 uses the SL1 components of RNAP1 machinery to initiate MLL fusion- and AEP-dependent transcription.
26329759 2015 AF4 and AF4-MLL mediate transcriptional elongation of 5-lipoxygenase mRNA by 1, 25-dihydroxyvitamin D3.
24735925 2014 Proteasome inhibitors evoke latent tumor suppression programs in pro-B MLL leukemias through MLL-AF4.
24367103 2014 AFF1 is a ubiquitous P-TEFb partner to enable Tat extraction of P-TEFb from 7SK snRNP and formation of SECs for HIV transactivation.
24189350 2013 Establishment of MLL/AF4 transgenic mice with the phenotype of lymphoblastic leukemia or lymphoma.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23568457 2013 Genetic variants associated with disordered eating.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23479570 2013 FLT3 activation cooperates with MLL-AF4 fusion protein to abrogate the hematopoietic specification of human ESCs.
23260655 2013 Leukemia fusion target AF9 is an intrinsically disordered transcriptional regulator that recruits multiple partners via coupled folding and binding.
More...