Property Summary

NCBI Gene PubMed Count 15
PubMed Score 27.97
PubTator Score 27.24

Knowledge Summary

Patent (4,444)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.900 0.011
oligodendroglioma 1.600 0.000
psoriasis 1.200 0.003
glioblastoma 1.200 0.000
group 4 medulloblastoma 3.300 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 2.000 0.000
lung cancer 1.300 0.002
posterior fossa group B ependymoma 1.300 0.000
lung carcinoma -1.500 0.000
Breast cancer -1.200 0.001
gastric carcinoma 1.800 0.012
ovarian cancer 2.200 0.000

Synonym

Accession P51817 PrKX
Symbols PKX1

Gene

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
22020623 findings reveals a major role of PRKX, TTBK2 and RSK4 in triggering Sunitinib resistance formation; data suggest transcriptional regulation of these kinases together with other proteins might play an important role in formation of Sunitinib resistance by affecting transcription factors
21971312 MBD 4--a potential substrate for protein kinase X
21684272 The interaction of PRKX with Pin-1, Magi-1 and Bag-3 could contribute to the stimulating role of PRKX in angiogenesis.
18187620 Knockdown of protein kinase, X-linked (PRKX) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17980165 PRKX can restore normal function to PKD1-deficient kidneys and have implications for the development of preventative therapy for autosomal dominant polycystic kidney disease
12082174 PRKX kinase may regulate epithelial morphogenesis during mammalian kidney development.

AA Sequence

MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFDTLATVGTGTFGRVHLVKEKT      1 - 70
AKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDERFLYMLMEYVPGGELFSYLRN     71 - 140
RGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEY    141 - 210
LAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLV    211 - 280
VDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQK    281 - 350
DLEIFKNF                                                                  351 - 358
//

Text Mined References (20)

PMID Year Title
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22020623 2012 PRKX, TTBK2 and RSK4 expression causes Sunitinib resistance in kidney carcinoma- and melanoma-cell lines.
21971312 2011 MBD 4--a potential substrate for protein kinase X.
21684272 2011 PRKX critically regulates endothelial cell proliferation, migration, and vascular-like structure formation.
20819953 2010 Regulation of cAMP-dependent protein kinases: the human protein kinase X (PrKX) reveals the role of the catalytic subunit alphaH-alphaI loop.
19576564 2009 Gene conversion between the X chromosome and the male-specific region of the Y chromosome at a translocation hotspot.
19367327 2009 Protein kinase-X interacts with Pin-1 and Polycystin-1 during mouse kidney development.
17980165 2008 Protein kinase X (PRKX) can rescue the effects of polycystic kidney disease-1 gene (PKD1) deficiency.
16491121 2006 Smad6 is a protein kinase X phosphorylation substrate and is required for HL-60 cell differentiation.
More...