Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.58
PubTator Score 3.92

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical adenoma 1.005 3.9e-03
Breast cancer 2.100 2.8e-02
intraductal papillary-mucinous adenoma (... 1.300 4.8e-03
intraductal papillary-mucinous neoplasm ... 1.400 2.7e-02
lung cancer -1.400 1.0e-04
osteosarcoma -2.487 2.2e-08
ovarian cancer 1.300 3.2e-06
psoriasis -1.900 1.1e-04

AA Sequence

MAMRELNADSCSSPQMGAMWETSGSVKENSSQSKKYSTKIENLGPESACRHFWSFRYHEATGPLETISQL      1 - 70
QKLCHQWLRPEIHSKEQILEMLVLEQFLSILPKETQNWVQKHHPQNVKQALVLVEFLQREPDGTKNEVTA     71 - 140
HELGKEAVLLGGTAVAPGFKWKPAEPQPMGVFQKEYWNTYRVLQEQLGWNTHKETQPVYERAVHDQQMLA    141 - 210
LSEQKRIKHWKMASKLILPESLSLLTFEDVAVYFSEEEWQLLNPLEKTLYNDVMQDIYETVISLGLKLKN    211 - 280
DTGNDHPISVSTSEIQTSGCEVSKKTRMKIAQKTMGRENPGDTHSVQKWHRAFPRKKRKKPATCKQELPK    281 - 350
LMDLHGKGPTGEKPFKCQECGKSFRVSSDLIKHHRIHTGEKPYKCQQCDRRFRWSSDLNKHFMTHQGIKP    351 - 420
YRCSWCGKSFSHNTNLHTHQRIHTGEKPFKCDECGKRFIQNSHLIKHQRTHTGEQPYTCSLCKRNFSRRS    421 - 490
SLLRHQKLHRRREACLVSPN                                                      491 - 510
//

Text Mined References (11)

PMID Year Title