Property Summary

NCBI Gene PubMed Count 54
Grant Count 27
R01 Count 17
Funding $3,349,863.83
PubMed Score 191.46
PubTator Score 106.78

Knowledge Summary

Patent (19,518)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.489 0.006
non-small cell lung cancer -1.085 0.000
breast carcinoma -1.200 0.000
lung adenocarcinoma -1.400 0.000
invasive ductal carcinoma -1.100 0.017
ovarian cancer 1.100 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (32)

PMID Text
25649765 BMX directly inhibits a core component of the intrinsic apoptosis machinery opens opportunities to improve the efficacy of existing chemotherapy by potentiating BAK-driven cell death in cancer cells.
25499959 Report BMX-ARHGAP gene fusion in gastric cardia adenocarcinoma.
24860816 These findings suggested that polymorphisms of the BMX gene could be a potential predictor of clinical symptoms following mTBI.
24785188 The effects of dietary K(+) on Bmx were more pronounced
24722985 A cell-based bimolecular fluorescence complementation assay demonstrates that HIV-1 Nef interacts with the Tec family members Bmx, Btk, and Itk, but not with Tec or Txk in 293T cells
24709422 BMX is an antiapoptotic downstream effector of PI3K, independent of AKT.
24606948 Overexpression of ETK is associated with the malignancy and disease progression of renal cell carcinoma.
22449076 This review characterizes the role of BMX in inflamamtion, cardiovascular disease and cancer.
21481791 Constitutively active STAT3 rescued the effects of BMX downregulation, supporting that BMX signals through STAT3 in glioblastoma stem cells (GSCs).
21471444 study concludes that BMX is an essential component of inflammatory cytokine signaling and that catalytic, as well as noncatalytic functions of BMX are involved
More...

AA Sequence

MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEE      1 - 70
QTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKYHSGFFVDGKFLCCQQSCKAA     71 - 140
PGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSS    141 - 210
TSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP    211 - 280
ESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYH    281 - 350
VHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL    351 - 420
KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTE    421 - 490
YISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRY    491 - 560
VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHR    561 - 630
LYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH                             631 - 675
//

Text Mined References (61)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25649765 2015 BMX Negatively Regulates BAK Function, Thereby Increasing Apoptotic Resistance to Chemotherapeutic Drugs.
25499959 2014 Identification of a novel gene fusion (BMX-ARHGAP) in gastric cardia adenocarcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24860816 2014 The influence of BMX gene polymorphisms on clinical symptoms after mild traumatic brain injury.
24785188 2014 Sodium and potassium regulate endothelial phospholipase C-? and Bmx.
24709422 2014 BMX acts downstream of PI3K to promote colorectal cancer cell survival and pathway inhibition sensitizes to the BH3 mimetic ABT-737.
24606948 2014 The expression and role of tyrosine kinase ETK/BMX in renal cell carcinoma.
22449076 2012 BMX and its role in inflammation, cardiovascular disease, and cancer.
21481791 2011 Nonreceptor tyrosine kinase BMX maintains self-renewal and tumorigenic potential of glioblastoma stem cells by activating STAT3.
More...