Property Summary

Ligand Count 17
NCBI Gene PubMed Count 56
PubMed Score 206.61
PubTator Score 106.78

Knowledge Summary

Patent (19,518)

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma -1.200 1.3e-05
invasive ductal carcinoma -1.100 1.7e-02
lung adenocarcinoma -1.400 4.1e-08
non-small cell lung cancer -1.085 1.3e-16
osteosarcoma -1.489 6.1e-03
ovarian cancer 1.100 2.2e-07

Protein-protein Interaction (6)

Gene RIF (34)

AA Sequence

MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKIRCVEKVNLEE      1 - 70
QTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKYHSGFFVDGKFLCCQQSCKAA     71 - 140
PGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSS    141 - 210
TSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP    211 - 280
ESSSSEEEENLDDYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYH    281 - 350
VHTNAENKLYLAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL    351 - 420
KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTE    421 - 490
YISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRY    491 - 560
VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHR    561 - 630
LYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH                             631 - 675
//

Text Mined References (63)

PMID Year Title