Property Summary

NCBI Gene PubMed Count 131
Grant Count 114
R01 Count 80
Funding $6,462,050.65
PubMed Score 311.16
PubTator Score 163.26

Knowledge Summary

Patent (52,461)

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 1.200 0.001
osteosarcoma 1.401 0.008
medulloblastoma, large-cell -1.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.551 0.011
intraductal papillary-mucinous adenoma (... 1.200 0.025
group 4 medulloblastoma -1.200 0.002
Breast cancer -2.300 0.000
ovarian cancer -2.300 0.000
pancreatic cancer 1.200 0.003

Synonym

Accession P51812 B2R9V4 Q4VAP3 Q59H26 Q5JPK8 Q7Z3Z7 S6K-alpha-3
Symbols CLS
RSK
HU-3
RSK2
MRX19
ISPK-1
p90-RSK2
pp90RSK2
MAPKAPK1B
S6K-alpha3

Gene

PDB

4D9T   4D9U   4JG6   4JG7   4JG8   4NUS   4NW5   4NW6   5D9K   5D9L  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (65)

PMID Text
26977024 RSK1 and 3 but not RSK2 are down-regulated in breast tumour and are associated with disease progression. RSK may be a key component in the progression and metastasis of breast cancer.
26625210 Data show that the 90 kDa ribosomal protein S6 kinases RSK1 and RSK2 play a key role in the homing of ovarian cancer cells in metastatic sites by regulating cell adhesion and invasion.
26354035 This case is one of the few examples where RPS6KA3 mutations are associated with a non-specific X-linked mental retardation.
26297997 This is the first report of exon skipping from an exonic mutation of RPS6KA3, demonstrating that a missense mutation and concomitant disruption of normal splicing contribute to the manifestation of CLS
26158630 Results indicate that the phosphorylation of EphA2 at Ser-897 is controlled by RSK and the RSK-EphA2 axis might contribute to cell motility and promote tumour malignant progression.
25992613 miR-191 represses proliferation in primary human fibroblasts via targeting multiple proto-oncogenes, including CDK9, NOTCH2, and RPS6KA3.
25889895 SL0101 and BI-D1870 induce distinct off-target effects in mTORC1-p70S6K signaling, and thus, the functions previously ascribed to RSK1/2 based on these inhibitors should be reassessed.
25855080 Study identifies RSK2 as a new kinase that regulates NHE3 activity by direct phosphorylation.
25624005 Rsk2-mediated inhibition of hyperplasia has now been demonstrated to occur in the arthritic synovium.
25044551 RPS6KA3 in three unrelated Coffin-Lowry syndrome patients including one from the historical Coffin-Lowry syndrome family and found two novel mutations, were analyzed.
More...

AA Sequence

MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFEL      1 - 70
LKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTE     71 - 140
GKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLT    141 - 210
DFGLSKESIDHEKKAYSFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMI    211 - 280
LKAKLGMPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGR    281 - 350
PEDTFYFDPEFTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD    351 - 420
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLKDVYDDGKYVY    421 - 490
VVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDLKPSNILYVDESGNPESIRIC    491 - 560
DFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEEIL    561 - 630
ARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVK    631 - 700
GAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL                                  701 - 740
//

Text Mined References (146)

PMID Year Title
26977024 2016 The Clinical Implications of RSK1-3 in Human Breast Cancer.
26625210 2016 Peritoneal and hematogenous metastases of ovarian cancer cells are both controlled by the p90RSK through a self-reinforcing cell autonomous mechanism.
26354035 2015 625 kb microduplication at Xp22.12 including RPS6KA3 in a child with mild intellectual disability.
26297997 2016 Concomitant partial exon skipping by a unique missense mutation of RPS6KA3 causes Coffin-Lowry syndrome.
26158630 2015 Crucial roles of RSK in cell motility by catalysing serine phosphorylation of EphA2.
25992613 2015 MiR-191 Regulates Primary Human Fibroblast Proliferation and Directly Targets Multiple Oncogenes.
25889895 2015 Two widely used RSK inhibitors, BI-D1870 and SL0101, alter mTORC1 signaling in a RSK-independent manner.
25855080 2015 Regulation of NHE3 by lysophosphatidic acid is mediated by phosphorylation of NHE3 by RSK2.
25624005 2015 Rheumatoid arthritis. The two faces of Rsk2 in hyperplastic disease.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
More...