Property Summary

NCBI Gene PubMed Count 58
PubMed Score 53.66
PubTator Score 42.81

Knowledge Summary

Patent (1,917)

Expression

  Differential Expression (4)

Disease log2 FC p
cutaneous lupus erythematosus -1.600 2.1e-02
invasive ductal carcinoma 1.100 4.1e-02
malignant mesothelioma -2.500 3.3e-08
posterior fossa group B ependymoma 1.100 1.0e-04

Gene RIF (42)

AA Sequence

MASPRLGTFCCPTRDAATQLVLSFQPRAFHALCLGSGGLRLALGLLQLLPGRRPAGPGSPATSPPASVRI      1 - 70
LRAAAACDLLGCLGMVIRSTVWLGFPNFVDSVSDMNHTEIWPAAFCVGSAMWIQLLYSACFWWLFCYAVD     71 - 140
AYLVIRRSAGLSTILLYHIMAWGLATLLCVEGAAMLYYPSVSRCERGLDHAIPHYVTMYLPLLLVLVANP    141 - 210
ILFQKTVTAVASLLKGRQGIYTENERRMGAVIKIRFFKIMLVLIICWLSNIINESLLFYLEMQTDINGGS    211 - 280
LKPVRTAAKTTWFIMGILNPAQGFLLSLAFYGWTGCSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHEN    281 - 350
PASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPTHGDL                    351 - 404
//

Text Mined References (60)

PMID Year Title