Property Summary

NCBI Gene PubMed Count 66
Grant Count 30
R01 Count 20
Funding $2,332,980.01
PubMed Score 81.72
PubTator Score 65.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 2.270 0.002
psoriasis 1.700 0.000
medulloblastoma, large-cell -1.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.679 0.006
ovarian cancer -2.000 0.000

Gene RIF (38)

PMID Text
26553929 GLUT5 required an interaction cascade of Rab11, Myo5B, Slp4a, Munc18-2, and Vamp7 with Stx3.
25999457 VAMP-7 participates in both platelet granule secretion and spreading and suggest a mechanism whereby VAMP-7 links granule exocytosis with actin reorganization.
25046114 highlight the role that VAMP3 and VAMP7 play in selection of the pathways leading to generation of ultrastructurally different LC3 compartments
24880616 increased gene dosage of VAMP7, and thus higher expression levels of its protein product, enhances estrogen receptor action in male genitourinary tissues
24807903 Increased level of SNAP23-Syntaxin4-VAMP7 interaction correlates with decreased Syntaxin4 phosphorylation and trafficking of MT1-MMP to invadopodia during cellular invasion.
24173214 Inhibition of endocytosis by siRNA-mediated depletion of EPS15, STX7, RAB7, and VAMP7 restores Gag/p24 expression in the presence of APOL1
24173214 Inhibition of endocytosis by siRNA-mediated depletion of EPS15, STX7, RAB7, and VAMP7 restores Gag/p24 expression in the presence of APOL1
23741335 CALM is able to sort VAMP4 and VAMP7, even though they have sorting signals for other clathrin adaptors.
23471971 Activation of TI-VAMP-mediated exocytosis thus relies on tyrosine phosphorylation.
23322049 hVps41 and VAMP7 are specifically involved in the fusion of trans-Golgi network-derived lysosome-associated membrane protein carriers with late endosomes.
More...

AA Sequence

MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDF      1 - 70
ERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIM     71 - 140
VRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCG    141 - 210
GFTWPSCVKK                                                                211 - 220
//

Text Mined References (72)

PMID Year Title
26553929 2015 Cargo-selective apical exocytosis in epithelial cells is conducted by Myo5B, Slp4a, Vamp7, and Syntaxin 3.
26359495 2015 The Q-soluble N-Ethylmaleimide-sensitive Factor Attachment Protein Receptor (Q-SNARE) SNAP-47 Regulates Trafficking of Selected Vesicle-associated Membrane Proteins (VAMPs).
25999457 2015 VAMP-7 links granule exocytosis to actin reorganization during platelet activation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25046114 2014 Role of VAMP3 and VAMP7 in the commitment of Yersinia pseudotuberculosis to LC3-associated pathways involving single- or double-membrane vacuoles.
24880616 2014 Increased gene copy number of VAMP7 disrupts human male urogenital development through altered estrogen action.
24807903 2014 SNAP23, Syntaxin4, and vesicle-associated membrane protein 7 (VAMP7) mediate trafficking of membrane type 1-matrix metalloproteinase (MT1-MMP) during invadopodium formation and tumor cell invasion.
24550300 2014 UVRAG is required for virus entry through combinatorial interaction with the class C-Vps complex and SNAREs.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23741335 2013 Uncoupling the functions of CALM in VAMP sorting and clathrin-coated pit formation.
More...