Property Summary

NCBI Gene PubMed Count 66
PubMed Score 83.49
PubTator Score 65.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
46,XY partial gonadal dysgenesis 9

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell -1.300 3.9e-04
Multiple myeloma 2.270 1.6e-03
ovarian cancer -2.000 5.0e-08
pancreatic ductal adenocarcinoma liver m... -1.679 6.5e-03
psoriasis 1.700 5.8e-05

Protein-protein Interaction (2)

Gene RIF (36)

AA Sequence

MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDF      1 - 70
ERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIM     71 - 140
VRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCG    141 - 210
GFTWPSCVKK                                                                211 - 220
//

Text Mined References (72)

PMID Year Title