Property Summary

NCBI Gene PubMed Count 17
Grant Count 5
R01 Count 5
Funding $224,953.33
PubMed Score 6.34
PubTator Score 8.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.324 0.045
malignant mesothelioma -3.500 0.000
astrocytic glioma -2.800 0.002
ependymoma -2.600 0.012
oligodendroglioma -3.000 0.017
group 4 medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.700 0.006
acute quadriplegic myopathy 1.146 0.000
progressive supranuclear palsy -1.100 0.016
ovarian cancer -1.900 0.000
dermatomyositis 1.200 0.003

 GO Function (1)

Gene RIF (2)

PMID Text
21166973 These data show that both DYNLT1 and DYNLT3 interact with L2 of human papillomavirus 16 during virus infection.
20668116 The N-terminal half of pUL35, in particular residues 30-43, was identified as a common region for the binding of DYNLT1 and DYNLT3.

AA Sequence

MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAV      1 - 70
VQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL                             71 - 116
//

Text Mined References (18)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
21166973 2011 Identification of the dynein light chains required for human papillomavirus infection.
20668116 2010 Identification of binding domains in the herpes simplex virus type 1 small capsid protein pUL35 (VP26).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17676955 2007 Dynein modifiers in C. elegans: light chains suppress conditional heavy chain mutants.
17289665 2007 The DYNLT3 light chain directly links cytoplasmic dynein to a spindle checkpoint protein, Bub3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16079286 2005 Dynein light chain rp3 acts as a nuclear matrix-associated transcriptional modulator in a dynein-independent pathway.
More...