Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.25
PubTator Score 8.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.146 6.5e-05
astrocytic glioma -2.800 2.1e-03
atypical teratoid / rhabdoid tumor -1.600 2.8e-06
dermatomyositis 1.200 3.3e-03
ependymoma -2.600 1.2e-02
group 3 medulloblastoma -1.100 7.5e-03
malignant mesothelioma -3.500 2.8e-09
medulloblastoma, large-cell -1.900 5.0e-05
Multiple myeloma 1.324 4.5e-02
oligodendroglioma -3.000 1.7e-02
ovarian cancer -1.900 2.9e-05
primitive neuroectodermal tumor -1.700 5.6e-03
progressive supranuclear palsy -1.100 1.6e-02

Gene RIF (2)

AA Sequence

MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAV      1 - 70
VQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL                             71 - 116
//

Text Mined References (18)

PMID Year Title