Property Summary

Ligand Count 1
NCBI Gene PubMed Count 51
PubMed Score 90.57
PubTator Score 97.49

Knowledge Summary

Patent (2,776)

TINX Plot

  Disease (5)

Disease Target Count P-value
psoriasis 6694 9.5e-13
pituitary cancer 1972 2.0e-03

Expression

  Differential Expression (2)

Disease log2 FC p
pituitary cancer 1.400 2.0e-03
psoriasis -1.200 9.5e-13

Gene RIF (44)

AA Sequence

MEEFVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRLGEDWYFLMTLGVLMALVSCAMDLA      1 - 70
VESVVRAHQWLYREIGDSHLLRYLSWTVYPVALVSFSSGFSQSITPSSGGSGIPEVKTMLAGVVLEDYLD     71 - 140
IKNFGAKVVGLSCTLACGSTLFLGKVGPFVHLSVMMAAYLGRVRTTTIGEPENKSKQNEMLVAAAAVGVA    141 - 210
TVFAAPFSGVLFSIEVMSSHFSVWDYWRGFFAATCGAFMFRLLAVFNSEQETITSLYKTSFRVDVPFDLP    211 - 280
EIFFFVALGGLCGILGSAYLFCQRIFFGFIRNNRFSSKLLATSKPVYSALATLVLASITYPPSAGRFLAS    281 - 350
RLSMKQHLDSLFDNHSWALMTQNSSPPWPEELDPQHLWWEWYHPRFTIFGTLAFFLVMKFWMLILATTIP    351 - 420
MPAGYFMPIFVYGAAIGRLFGETLSFIFPEGIVAGGITNPIMPGGYALAGAAAFSGAVTHTISTALLAFE    421 - 490
VTGQIVHALPVLMAVLAANAIAQSCQPSFYDGTVIVKKLPYLPRILGRNIGSHRVRVEHFMNHSITTLAK    491 - 560
DMPLEEVVKVVTSTDVAKYPLVESTESQILVGIVRRAQLVQALKAEPPSWAPGHQQCLQDILAAGCPTEP    561 - 630
VTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSWVEMKKAISNLTNPPAPK                 631 - 687
//

Text Mined References (53)

PMID Year Title