Property Summary

NCBI Gene PubMed Count 55
Grant Count 66
R01 Count 45
Funding $8,661,149.14
PubMed Score 194.92
PubTator Score 116.83

Knowledge Summary

Patent (10,592)

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 1.600 0.002
gastric cancer 1.100 0.004
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.600 0.001
Multiple myeloma 1.203 0.007
malignant mesothelioma -1.300 0.000
psoriasis 1.600 0.000
osteosarcoma 1.720 0.000
astrocytoma 1.500 0.009
hereditary spastic paraplegia -1.046 0.036
tuberculosis and treatment for 6 months -2.800 0.000
intraductal papillary-mucinous adenoma (... 1.600 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.005
lung cancer 1.800 0.002
interstitial cystitis -1.400 0.000
pancreatic carcinoma 1.600 0.001
aldosterone-producing adenoma -1.120 0.043
lung adenocarcinoma 1.094 0.000
lung carcinoma 1.300 0.000
spina bifida -1.358 0.036
acute myeloid leukemia -1.800 0.039
ovarian cancer 1.900 0.000

Synonym

Accession P51790 B7Z932 B9EGJ9 D3DP34 E9PB97 O14918 Q86Z21
Symbols CLC3
ClC-3

Gene

 GWAS Trait (1)

Gene RIF (34)

PMID Text
25973047 these results demonstrated that ClC-3 is involved in the proliferation and migration of osteosarcoma cell
25537517 Data indicate that cytoplasmic chloride channel-3 (ClC-3) plays an active and key role in tumor metastasis and may be a valuable prognostic biomarker and a therapeutic target to prevent tumor spread.
25514499 CLC3 is required in the activation and migration of human blood eosinophils.
25421907 Authors summarize the function of CLC-3 in cancer and discuss the mechanisms by which CLC-3 contributes to proliferation, apoptosis and drug resistance in cancer cells. [Review]
24284495 swelling-activated Cl currents and CLC-3 play a role in pulmonary artery smooth muscle cell proliferation, but CLC-3 channels do not underlie swelling in these cells
23873092 ClC-3 deficiency inhibited Ang II-induced EPC apoptosis via suppressing ROS generation derived from NADPH oxidase.
23408563 Suggest that ClC-3 suppression causes the inhibition of Akt and autophagy, which can enhance the therapeutic benefit of cisplatin in U251 cells.
23345219 K(Ca)3.1 and ClC-3 are expressed in tissue samples obtained from patients diagnosed with grade IV gliomas. Both K(Ca)3.1 and ClC-3 colocalize to the invading processes of glioma cells
23270726 our data suggest that the ClC-3 chloride channel is an important target of cyclin D1. Cyclin D1 may regulate the functional activities of the chloride channel via CDK4 and CDK6, and/or the expression of the chloride channel.
23006728 Data indicate in umbilical vein endothelial cells transfected with ClC-3 siRNA showed activation of NF-kappaB.
More...

AA Sequence

MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTH      1 - 70
LLDLLDEPIPGVGTYDDFHTIDWVREKCKDRERHRRINSKKKESAWEMTKSLYDAWSGWLVVTLTGLASG     71 - 140
ALAGLIDIAADWMTDLKEGICLSALWYNHEQCCWGSNETTFEERDKCPQWKTWAELIIGQAEGPGSYIMN    141 - 210
YIMYIFWALSFAFLAVSLVKVFAPYACGSGIPEIKTILSGFIIRGYLGKWTLMIKTITLVLAVASGLSLG    211 - 280
KEGPLVHVACCCGNIFSYLFPKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLW    281 - 350
RSFFAALVAAFVLRSINPFGNSRLVLFYVEYHTPWYLFELFPFILLGVFGGLWGAFFIRANIAWCRRRKS    351 - 420
TKFGKYPVLEVIIVAAITAVIAFPNPYTRLNTSELIKELFTDCGPLESSSLCDYRNDMNASKIVDDIPDR    421 - 490
PAGIGVYSAIWQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAYYHHDWFIFKE    491 - 560
WCEVGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIY    561 - 630
EAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSKES    631 - 700
QRLVGFALRRDLTIAIESARKKQEGIVGSSRVCFAQHTPSLPAESPRPLKLRSILDMSPFTVTDHTPMEI    701 - 770
VVDIFRKLGLRQCLVTHNGRLLGIITKKDILRHMAQTANQDPASIMFN                          771 - 818
//

Text Mined References (59)

PMID Year Title
25973047 2015 ClC-3 chloride channel modulates the proliferation and migration of osteosarcoma cells via AKT/GSK3? signaling pathway.
25537517 2015 Chloride channel-3 promotes tumor metastasis by regulating membrane ruffling and is associated with poor survival.
25514499 2015 Chloride Channel 3 Channels in the Activation and Migration of Human Blood Eosinophils in Allergic Asthma.
25421907 2015 CLC-3 channels in cancer (review).
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24284495 2014 Swelling-activated Cl- currents and intracellular CLC-3 are involved in proliferation of human pulmonary artery smooth muscle cells.
23873092 2013 ClC-3 deficiency prevents apoptosis induced by angiotensin II in endothelial progenitor cells via inhibition of NADPH oxidase.
23408563 2013 Suppression of chloride channel 3 expression facilitates sensitivity of human glioma U251 cells to cisplatin through concomitant inhibition of Akt and autophagy.
23345219 2013 Bradykinin-induced chemotaxis of human gliomas requires the activation of KCa3.1 and ClC-3.
23270726 2013 The ClC-3 chloride channel protein is a downstream target of cyclin D1 in nasopharyngeal carcinoma cells.
More...