Property Summary

Ligand Count 1
NCBI Gene PubMed Count 58
PubMed Score 203.42
PubTator Score 116.83

Knowledge Summary

Patent (10,592)

Expression

  Differential Expression (22)

Disease log2 FC p
acute myeloid leukemia -1.800 3.9e-02
aldosterone-producing adenoma -1.120 4.3e-02
astrocytoma 1.500 9.3e-03
gastric cancer 1.100 3.8e-03
hepatocellular carcinoma 1.200 1.1e-05
hereditary spastic paraplegia -1.046 3.6e-02
interstitial cystitis -1.300 2.2e-03
intraductal papillary-mucinous adenoma (... 1.600 1.0e-04
intraductal papillary-mucinous carcinoma... 1.100 5.4e-03
lung adenocarcinoma 1.094 1.6e-05
lung cancer 1.600 2.6e-03
lung carcinoma 1.300 2.2e-28
malignant mesothelioma -1.300 8.2e-05
Multiple myeloma 1.203 6.7e-03
osteosarcoma 1.720 2.1e-06
ovarian cancer -1.700 3.5e-06
pancreatic cancer 1.100 7.2e-03
pancreatic carcinoma 1.100 7.2e-03
psoriasis 1.600 1.1e-08
Rheumatoid arthritis 1.600 1.9e-03
spina bifida -1.358 3.6e-02
tuberculosis -1.300 1.1e-05

Gene RIF (37)

AA Sequence

MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTH      1 - 70
LLDLLDEPIPGVGTYDDFHTIDWVREKCKDRERHRRINSKKKESAWEMTKSLYDAWSGWLVVTLTGLASG     71 - 140
ALAGLIDIAADWMTDLKEGICLSALWYNHEQCCWGSNETTFEERDKCPQWKTWAELIIGQAEGPGSYIMN    141 - 210
YIMYIFWALSFAFLAVSLVKVFAPYACGSGIPEIKTILSGFIIRGYLGKWTLMIKTITLVLAVASGLSLG    211 - 280
KEGPLVHVACCCGNIFSYLFPKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLW    281 - 350
RSFFAALVAAFVLRSINPFGNSRLVLFYVEYHTPWYLFELFPFILLGVFGGLWGAFFIRANIAWCRRRKS    351 - 420
TKFGKYPVLEVIIVAAITAVIAFPNPYTRLNTSELIKELFTDCGPLESSSLCDYRNDMNASKIVDDIPDR    421 - 490
PAGIGVYSAIWQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAYYHHDWFIFKE    491 - 560
WCEVGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIY    561 - 630
EAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSKES    631 - 700
QRLVGFALRRDLTIAIESARKKQEGIVGSSRVCFAQHTPSLPAESPRPLKLRSILDMSPFTVTDHTPMEI    701 - 770
VVDIFRKLGLRQCLVTHNGRLLGIITKKDILRHMAQTANQDPASIMFN                          771 - 818
//

Text Mined References (62)

PMID Year Title