Property Summary

NCBI Gene PubMed Count 55
PubMed Score 194.92
PubTator Score 116.83

Knowledge Summary

Patent (10,592)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 2.15711313133411E-28
psoriasis 6685 1.0632718318395E-8
osteosarcoma 7933 2.08000197338504E-6
interstitial cystitis 2299 7.8253014300454E-6
hepatocellular carcinoma 550 1.12126653617372E-5
lung adenocarcinoma 2714 1.56523014136354E-5
tuberculosis and treatment for 6 months 686 2.15260185716512E-5
malignant mesothelioma 3163 8.19657940212376E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.02666974069898E-4
ovarian cancer 8492 1.44778547174229E-4
pancreatic cancer 2300 6.7292025990306E-4
pancreatic carcinoma 567 6.72920259903072E-4
Rheumatoid Arthritis 1171 0.0019009377842027
lung cancer 4473 0.00204502355749523
gastric cancer 436 0.00379458933842179
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00536884511277686
Multiple myeloma 1328 0.00666300576098164
astrocytoma 1493 0.00929925134460944
spina bifida 1064 0.035817889435841
hereditary spastic paraplegia 313 0.0360301441733976
acute myeloid leukemia 785 0.0390847932009602
aldosterone-producing adenoma 664 0.0434103015825068

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 1.600 0.002
gastric cancer 1.100 0.004
hepatocellular carcinoma 1.200 0.000
pancreatic cancer 1.600 0.001
Multiple myeloma 1.203 0.007
malignant mesothelioma -1.300 0.000
psoriasis 1.600 0.000
osteosarcoma 1.720 0.000
astrocytoma 1.500 0.009
hereditary spastic paraplegia -1.046 0.036
tuberculosis and treatment for 6 months -2.800 0.000
intraductal papillary-mucinous adenoma (... 1.600 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.005
lung cancer 1.800 0.002
interstitial cystitis -1.400 0.000
pancreatic carcinoma 1.600 0.001
aldosterone-producing adenoma -1.120 0.043
lung adenocarcinoma 1.094 0.000
lung carcinoma 1.300 0.000
spina bifida -1.358 0.036
acute myeloid leukemia -1.800 0.039
ovarian cancer 1.900 0.000

Synonym

Accession P51790 B7Z932 B9EGJ9 D3DP34 E9PB97 O14918 Q86Z21
Symbols CLC3
ClC-3

Gene

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (34)

PMID Text
25973047 these results demonstrated that ClC-3 is involved in the proliferation and migration of osteosarcoma cell
25537517 Data indicate that cytoplasmic chloride channel-3 (ClC-3) plays an active and key role in tumor metastasis and may be a valuable prognostic biomarker and a therapeutic target to prevent tumor spread.
25514499 CLC3 is required in the activation and migration of human blood eosinophils.
25421907 Authors summarize the function of CLC-3 in cancer and discuss the mechanisms by which CLC-3 contributes to proliferation, apoptosis and drug resistance in cancer cells. [Review]
24284495 swelling-activated Cl currents and CLC-3 play a role in pulmonary artery smooth muscle cell proliferation, but CLC-3 channels do not underlie swelling in these cells
23873092 ClC-3 deficiency inhibited Ang II-induced EPC apoptosis via suppressing ROS generation derived from NADPH oxidase.
23408563 Suggest that ClC-3 suppression causes the inhibition of Akt and autophagy, which can enhance the therapeutic benefit of cisplatin in U251 cells.
23345219 K(Ca)3.1 and ClC-3 are expressed in tissue samples obtained from patients diagnosed with grade IV gliomas. Both K(Ca)3.1 and ClC-3 colocalize to the invading processes of glioma cells
23270726 our data suggest that the ClC-3 chloride channel is an important target of cyclin D1. Cyclin D1 may regulate the functional activities of the chloride channel via CDK4 and CDK6, and/or the expression of the chloride channel.
23006728 Data indicate in umbilical vein endothelial cells transfected with ClC-3 siRNA showed activation of NF-kappaB.
More...

AA Sequence

MESEQLFHRGYYRNSYNSITSASSDEELLDGAGVIMDFQTSEDDNLLDGDTAVGTHYTMTNGGSINSSTH      1 - 70
LLDLLDEPIPGVGTYDDFHTIDWVREKCKDRERHRRINSKKKESAWEMTKSLYDAWSGWLVVTLTGLASG     71 - 140
ALAGLIDIAADWMTDLKEGICLSALWYNHEQCCWGSNETTFEERDKCPQWKTWAELIIGQAEGPGSYIMN    141 - 210
YIMYIFWALSFAFLAVSLVKVFAPYACGSGIPEIKTILSGFIIRGYLGKWTLMIKTITLVLAVASGLSLG    211 - 280
KEGPLVHVACCCGNIFSYLFPKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLW    281 - 350
RSFFAALVAAFVLRSINPFGNSRLVLFYVEYHTPWYLFELFPFILLGVFGGLWGAFFIRANIAWCRRRKS    351 - 420
TKFGKYPVLEVIIVAAITAVIAFPNPYTRLNTSELIKELFTDCGPLESSSLCDYRNDMNASKIVDDIPDR    421 - 490
PAGIGVYSAIWQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAYYHHDWFIFKE    491 - 560
WCEVGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMAAVMTSKWVGDAFGREGIY    561 - 630
EAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSKES    631 - 700
QRLVGFALRRDLTIAIESARKKQEGIVGSSRVCFAQHTPSLPAESPRPLKLRSILDMSPFTVTDHTPMEI    701 - 770
VVDIFRKLGLRQCLVTHNGRLLGIITKKDILRHMAQTANQDPASIMFN                          771 - 818
//

Text Mined References (59)

PMID Year Title
25973047 2015 ClC-3 chloride channel modulates the proliferation and migration of osteosarcoma cells via AKT/GSK3? signaling pathway.
25537517 2015 Chloride channel-3 promotes tumor metastasis by regulating membrane ruffling and is associated with poor survival.
25514499 2015 Chloride Channel 3 Channels in the Activation and Migration of Human Blood Eosinophils in Allergic Asthma.
25421907 2015 CLC-3 channels in cancer (review).
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24284495 2014 Swelling-activated Cl- currents and intracellular CLC-3 are involved in proliferation of human pulmonary artery smooth muscle cells.
23873092 2013 ClC-3 deficiency prevents apoptosis induced by angiotensin II in endothelial progenitor cells via inhibition of NADPH oxidase.
23408563 2013 Suppression of chloride channel 3 expression facilitates sensitivity of human glioma U251 cells to cisplatin through concomitant inhibition of Akt and autophagy.
23345219 2013 Bradykinin-induced chemotaxis of human gliomas requires the activation of KCa3.1 and ClC-3.
23270726 2013 The ClC-3 chloride channel protein is a downstream target of cyclin D1 in nasopharyngeal carcinoma cells.
More...