Property Summary

NCBI Gene PubMed Count 42
Grant Count 72
R01 Count 42
Funding $9,306,715.28
PubMed Score 99.40
PubTator Score 174.39

Knowledge Summary

Patent (27,269)

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.159 0.014
ulcerative colitis -1.700 0.000

Synonym

Accession P51788 B4DQT9 B4DZ58 E9PBD9 E9PCD2 O14864 Q6IPA9 Q8WU13 ClC-2
Symbols CLC2
ECA2
ECA3
EGI3
EGMA
EJM6
EJM8
CIC-2
EGI11
LKPAT
clC-2

Gene

Gene RIF (37)

PMID Text
26666914 Hyperpolarization activates CLC-2 mainly by driving intracellular anions into the channel pores.
26033718 The extracellular domain of GlialCAM is necessary for cell junction targeting and for mediating interactions with itself or with MLC1 and ClC-2.
25739457 both ubiquitous (AP-1A) and epithelium-specific (AP-1B) forms of the tetrameric clathrin adaptor AP-1 are capable of carrying out basolateral sorting of ClC-2.
25323061 SPAK and OSR1 are powerful negative regulators of the cell volume regulatory Cl- channel ClC-2
23934342 Correlation between CLC-2 gene expression and the cytoskeleton in human trabecular meshwork cells.
23707145 Our observations substantiate the concept that ClC-2 is involved in brain ion and water homoeostasis
22613974 JAK2 down-regulates ClC-2 activity and thus counteracts Cl(-) exit, an effect which may impact on cell volume regulation
22405205 This study demonistrated that the first auxiliary subunit of ClC-2 and suggests that ClC-2 may play a role in the pathology of MLC disease.
21956164 ClC-2 plays an important role in the modulation of tight junctions by influencing caveolar trafficking of tight junction protein occludin.
20187760 Sequence analysis of CLCN2 at genomic DNA and cDNA levels in 18 megalencephalic leukoencephalopathy MLC1 mutations revealed some nucleotide changes, but they were predicted to be nonpathogenic.
More...

AA Sequence

MAAAAAEEGMEPRALQYEQTLMYGRYTQDLGAFAKEEAARIRLGGPEPWKGPPSSRAAPELLEYGRSRCA      1 - 70
RCRVCSVRCHKFLVSRVGEDWIFLVLLGLLMALVSWVMDYAIAACLQAQQWMSRGLNTSILLQYLAWVTY     71 - 140
PVVLITFSAGFTQILAPQAVGSGIPEMKTILRGVVLKEYLTLKTFIAKVIGLTCALGSGMPLGKEGPFVH    141 - 210
IASMCAALLSKFLSLFGGIYENESRNTEMLAAACAVGVGCCFAAPIGGVLFSIEVTSTFFAVRNYWRGFF    211 - 280
AATFSAFIFRVLAVWNRDEETITALFKTRFRLDFPFDLQELPAFAVIGIASGFGGALFVYLNRKIVQVMR    281 - 350
KQKTINRFLMRKRLLFPALVTLLISTLTFPPGFGQFMAGQLSQKETLVTLFDNRTWVRQGLVEELEPPST    351 - 420
SQAWNPPRANVFLTLVIFILMKFWMSALATTIPVPCGAFMPVFVIGAAFGRLVGESMAAWFPDGIHTDSS    421 - 490
TYRIVPGGYAVVGAAALAGAVTHTVSTAVIVFELTGQIAHILPVMIAVILANAVAQSLQPSLYDSIIRIK    491 - 560
KLPYLPELGWGRHQQYRVRVEDIMVRDVPHVALSCTFRDLRLALHRTKGRMLALVESPESMILLGSIERS    561 - 630
QVVALLGAQLSPARRRQHMQERRATQTSPLSDQEGPPTPEASVCFQVNTEDSAFPAARGETHKPLKPALK    631 - 700
RGPSVTRNLGESPTGSAESAGIALRSLFCGSPPPEAASEKLESCEKRKLKRVRISLASDADLEGEMSPEE    701 - 770
ILEWEEQQLDEPVNFSDCKIDPAPFQLVERTSLHKTHTIFSLLGVDHAYVTSIGRLIGIVTLKELRKAIE    771 - 840
GSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHGLPREGSPSDSDDKCQ                841 - 898
//

Text Mined References (49)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26666914 2016 Gating the glutamate gate of CLC-2 chloride channel by pore occupancy.
26033718 2015 Structural determinants of interaction, trafficking and function in the ClC-2/MLC1 subunit GlialCAM involved in leukodystrophy.
25739457 2015 Basolateral sorting of chloride channel 2 is mediated by interactions between a dileucine motif and the clathrin adaptor AP-1.
25323061 2014 Regulation of ClC-2 activity by SPAK and OSR1.
23934342 2013 Effect of CLC-2 on the cytoskeleton in human trabecular meshwork cells.
23707145 2013 Brain white matter oedema due to ClC-2 chloride channel deficiency: an observational analytical study.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22613974 2012 Downregulation of ClC-2 by JAK2.
More...