Property Summary

Ligand Count 32
NCBI Gene PubMed Count 500
PubMed Score 800.22
PubTator Score 891.02

Knowledge Summary

Patent (28,227)

TINX Plot

  Disease (10)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 1.4
Type 2 diabetes mellitus 272 0.0 2.7
Disease Target Count Z-score Confidence
Short QT syndrome 12 5.989 3.0
Gestational diabetes 26 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.147 2.1
Familial atrial fibrillation 23 0.0 4.0

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma -2.725 2.9e-08
esophageal adenocarcinoma 1.500 2.3e-02
gastric carcinoma -1.200 1.1e-02
lung adenocarcinoma -1.300 1.3e-03
primary pancreatic ductal adenocarcinoma -1.189 1.4e-02
tuberculosis 1.400 5.4e-06

Gene RIF (456)

AA Sequence

MAAASSPPRAERKRWGWGRLPGARRGSAGLAKKCPFSLELAEGGPAGGALYAPIAPGAPGPAPPASPAAP      1 - 70
AAPPVASDLGPRPPVSLDPRVSIYSTRRPVLARTHVQGRVYNFLERPTGWKCFVYHFAVFLIVLVCLIFS     71 - 140
VLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCRSKYVGLWGRLRFARKPISIIDLIVVVASM    141 - 210
VVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFV    211 - 280
YLAEKDAVNESGRVEFGSYADALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSG    281 - 350
FALKVQQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKIYIRKAPRSHTLLSPSPKPKKSVVVKK    351 - 420
KKFKLDKDNGVTPGEKMLTVPHITCDPPEERRLDHFSVDGYDSSVRKSPTLLEVSMPHFMRTNSFAEDLD    421 - 490
LEGETLLTPITHISQLREHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDVIEQYSQGHLNLMVRIKELQ    491 - 560
RRLDQSIGKPSLFISVSEKSKDRGSNTIGARLNRVEDKVTQLDQRLALITDMLHQLLSLHGGSTPGSGGP    561 - 630
PREGGAHITQPCGSGGSVDPELFLPSNTLPTYEQLTVPRRGPDEGS                            631 - 676
//

Text Mined References (502)

PMID Year Title