Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.50
PubTator Score 1.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
non primary Sjogren syndrome sicca 840

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.300 0.026

AA Sequence

MPANGTSPQRFPALIPGEPGRSFEGSVSFEDVAVDFTRQEWHRLDPAQRTMHKDVMLETYSNLASVGLCV      1 - 70
AKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCR     71 - 140
KAFHEKTGFVRRKRTPRGDKNFECHECGKAYCRKSNLVEHLRIHTGERPYECGECAKTFSARSYLIAHQK    141 - 210
THTGERPFECNECGKSFGRKSQLILHTRTHTGERPYECTECGKTFSEKATLTIHQRTHTGEKPYECSECG    211 - 280
KTFRVKISLTQHHRTHTGEKPYECGECGKNFRAKKSLNQHQRIHTGEKPYECGECGKFFRMKMTLNNHQR    281 - 350
THTGEKPYQCNECGKSFRVHSSLGIHQRIHTGEKPYECNECGNAFYVKARLIEHQRMHSGEKPYECSECG    351 - 420
KIFSMKKSLCQHRRTHTGEKPYECSECGNAFYVKVRLIEHQRIHTGERPFECQECGKAFCRKAHLTEHQR    421 - 490
THIGWSWRCTMKKASH                                                          491 - 506
//

Text Mined References (7)

PMID Year Title
20395239 2010 Genome-wide association identifies ATOH7 as a major gene determining human optic disc size.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11944989 2002 An integrated, functionally annotated gene map of the DXS8026-ELK1 interval on human Xp11.3-Xp11.23: potential hotspot for neurogenetic disorders.
8586441 1995 Cloning and characterization of a novel zinc finger gene in Xp11.2.