Property Summary

NCBI Gene PubMed Count 30
Grant Count 6
R01 Count 5
Funding $326,785.6
PubMed Score 14.85
PubTator Score 13.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.400 0.000
juvenile dermatomyositis 1.000 0.000
adult high grade glioma -1.500 0.000
subependymal giant cell astrocytoma -1.793 0.017
lung carcinoma 1.200 0.000
ovarian cancer 1.700 0.000

Gene RIF (14)

PMID Text
26507658 These findings elucidate deeply and extensively the mechanism of RNF8/RNF168 and USP11 to maintain the proper status of ubiquitylation gammaH2AX to repair double strand breaks.
25969536 novel insight into cross-talk between ubiquitin and SUMO and uncover USP11 and RNF4 as a balanced SUMO-targeted ubiquitin ligase/protease pair with a role in the DDR.
25471832 USP11 is a novel regulator of p53, which is required for p53 activation in response to DNA damage
24724799 Our data support a model whereby USP11 domains outside the catalytic core domain serve as protein interaction or trafficking modules rather than a direct regulatory function of the proteolytic activity.
24487962 PML degradation mechanism through Notch/Hey1-induced repression of USP11 involved in brain tumour pathogenesis
23337751 USP-11 is not a predictor of a pCR after anthracycline-taxane-containing NST for breast cancer. Low USP-11 expression was independently correlated with better survival outcomes.
22773947 USP11 augments TGFbeta signalling by deubiquitylating ALK5.
22190034 HIV-1 Tat is identified to have a physical interaction with ubiquitin specific peptidase 11 (USP11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20601937 Ablation of either USP7 or USP11 in primary human fibroblasts results in de-repression of the INK4a tumour suppressor accompanied by loss of Polycomb repressive complex 1 binding at the locus and a senescence-like proliferative arrest.
19874889 Ubiquitin specific protease 11 protein plays an important role in maintaining a delicate balance in TNFalpha-mediated inflammatory responses by being a part of Yin-Yang regulatory mechanism.
More...

AA Sequence

MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRRERTAMATVAANPAAAAAAVAAAAAVTEDREP      1 - 70
QHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDE     71 - 140
INWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKS    141 - 210
HTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKD    211 - 280
GTWPSAQLHVMNNNMSEEDEDFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRN    281 - 350
PLGMKGEIAEAYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVK    351 - 420
KKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPI    421 - 490
SHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERMMVADVFSHRFYKLYQLEEPL    491 - 560
SSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPARDYNNSYYGLMLFGHPLLVSVPRDRFTWEG    561 - 630
LYNVLMYRLSRYVTKPNSDDEDDGDEKEDDEEDKDDVPGPSTGGSLRDPEPEQAGPSSGVTNRCPFLLDN    631 - 700
CLGTSQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCV    701 - 770
GYVMKKAPVRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREK    771 - 840
LDTLVEFPIRDLDFSEFVIQPQNESNPELYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVS    841 - 910
PVNENQIESKAAYVLFYQRQDVARRLLSPAGSSGAPASPACSSPPSSEFMDVN                     911 - 963
//

Text Mined References (39)

PMID Year Title
26507658 2016 USP11 Is a Negative Regulator to ?H2AX Ubiquitylation by RNF8/RNF168.
25969536 2015 Ubiquitin-specific Protease 11 (USP11) Deubiquitinates Hybrid Small Ubiquitin-like Modifier (SUMO)-Ubiquitin Chains to Counteract RING Finger Protein 4 (RNF4).
25471832 2014 USP11 regulates p53 stability by deubiquitinating p53.
24724799 2014 Structure and catalytic regulatory function of ubiquitin specific protease 11 N-terminal and ubiquitin-like domains.
24487962 2014 USP11 regulates PML stability to control Notch-induced malignancy in brain tumours.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23337751 USP-11 as a predictive and prognostic factor following neoadjuvant therapy in women with breast cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22773947 2012 USP11 augments TGF? signalling by deubiquitylating ALK5.
22190034 2011 Global landscape of HIV-human protein complexes.
More...