Property Summary

NCBI Gene PubMed Count 30
PubMed Score 14.85
PubTator Score 13.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.57240884700634E-27
juvenile dermatomyositis 1189 2.72524377214567E-11
ovarian cancer 8492 1.40400655965289E-6
adult high grade glioma 2148 5.20411347185624E-6
atypical teratoid / rhabdoid tumor 4369 7.78326293047609E-6
medulloblastoma, large-cell 6234 2.0579852904532E-4
subependymal giant cell astrocytoma 2287 0.0165522919011693
Disease Target Count Z-score Confidence
Eye and adnexa disease 11 0.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 0.000
medulloblastoma, large-cell -1.400 0.000
juvenile dermatomyositis 1.000 0.000
adult high grade glioma -1.500 0.000
subependymal giant cell astrocytoma -1.793 0.017
lung carcinoma 1.200 0.000
ovarian cancer 1.700 0.000

Synonym

Accession P51784 B2RTX1 Q8IUG6 Q9BWE1
Symbols UHX1

Gene

PDB

4MEL  

  Ortholog (11)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (14)

PMID Text
26507658 These findings elucidate deeply and extensively the mechanism of RNF8/RNF168 and USP11 to maintain the proper status of ubiquitylation gammaH2AX to repair double strand breaks.
25969536 novel insight into cross-talk between ubiquitin and SUMO and uncover USP11 and RNF4 as a balanced SUMO-targeted ubiquitin ligase/protease pair with a role in the DDR.
25471832 USP11 is a novel regulator of p53, which is required for p53 activation in response to DNA damage
24724799 Our data support a model whereby USP11 domains outside the catalytic core domain serve as protein interaction or trafficking modules rather than a direct regulatory function of the proteolytic activity.
24487962 PML degradation mechanism through Notch/Hey1-induced repression of USP11 involved in brain tumour pathogenesis
23337751 USP-11 is not a predictor of a pCR after anthracycline-taxane-containing NST for breast cancer. Low USP-11 expression was independently correlated with better survival outcomes.
22773947 USP11 augments TGFbeta signalling by deubiquitylating ALK5.
22190034 HIV-1 Tat is identified to have a physical interaction with ubiquitin specific peptidase 11 (USP11) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20601937 Ablation of either USP7 or USP11 in primary human fibroblasts results in de-repression of the INK4a tumour suppressor accompanied by loss of Polycomb repressive complex 1 binding at the locus and a senescence-like proliferative arrest.
19874889 Ubiquitin specific protease 11 protein plays an important role in maintaining a delicate balance in TNFalpha-mediated inflammatory responses by being a part of Yin-Yang regulatory mechanism.
More...

AA Sequence

MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRRERTAMATVAANPAAAAAAVAAAAAVTEDREP      1 - 70
QHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDE     71 - 140
INWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKS    141 - 210
HTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKD    211 - 280
GTWPSAQLHVMNNNMSEEDEDFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRN    281 - 350
PLGMKGEIAEAYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVK    351 - 420
KKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPI    421 - 490
SHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERMMVADVFSHRFYKLYQLEEPL    491 - 560
SSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPARDYNNSYYGLMLFGHPLLVSVPRDRFTWEG    561 - 630
LYNVLMYRLSRYVTKPNSDDEDDGDEKEDDEEDKDDVPGPSTGGSLRDPEPEQAGPSSGVTNRCPFLLDN    631 - 700
CLGTSQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCV    701 - 770
GYVMKKAPVRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREK    771 - 840
LDTLVEFPIRDLDFSEFVIQPQNESNPELYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVS    841 - 910
PVNENQIESKAAYVLFYQRQDVARRLLSPAGSSGAPASPACSSPPSSEFMDVN                     911 - 963
//

Text Mined References (39)

PMID Year Title
26507658 2016 USP11 Is a Negative Regulator to ?H2AX Ubiquitylation by RNF8/RNF168.
25969536 2015 Ubiquitin-specific Protease 11 (USP11) Deubiquitinates Hybrid Small Ubiquitin-like Modifier (SUMO)-Ubiquitin Chains to Counteract RING Finger Protein 4 (RNF4).
25471832 2014 USP11 regulates p53 stability by deubiquitinating p53.
24724799 2014 Structure and catalytic regulatory function of ubiquitin specific protease 11 N-terminal and ubiquitin-like domains.
24487962 2014 USP11 regulates PML stability to control Notch-induced malignancy in brain tumours.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23337751 USP-11 as a predictive and prognostic factor following neoadjuvant therapy in women with breast cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22773947 2012 USP11 augments TGF? signalling by deubiquitylating ALK5.
22190034 2011 Global landscape of HIV-human protein complexes.
More...