Property Summary

NCBI Gene PubMed Count 44
PubMed Score 62.57
PubTator Score 61.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.700 1.4e-04
aldosterone-producing adenoma -1.078 2.2e-02
astrocytic glioma -1.300 2.4e-02
Astrocytoma, Pilocytic -1.600 2.6e-07
atypical teratoid / rhabdoid tumor -1.100 2.7e-03
ependymoma -1.400 4.3e-02
gastric carcinoma -1.700 2.9e-02
glioblastoma -1.800 3.9e-08
group 3 medulloblastoma -1.200 2.4e-03
lung carcinoma 3.600 1.3e-59
malignant mesothelioma -1.200 1.4e-06
medulloblastoma, large-cell -1.100 3.0e-04
oligodendroglioma -1.400 1.5e-12
osteosarcoma 1.170 4.8e-03
pancreatic cancer -1.500 2.2e-03
primary pancreatic ductal adenocarcinoma -1.448 4.8e-03
subependymal giant cell astrocytoma -2.377 3.0e-02

Gene RIF (19)

AA Sequence

MGPASPAARGLSRRPGQPPLPLLLPLLLLLLRAQPAIGSLAGGSPGAAEAPGSAQVAGLCGRLTLHRDLR      1 - 70
TGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARVEQATQAIPMERWCGGSRSGSCAHPHHQVVPFRC     71 - 140
LPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEACSSQGLILHGSGMLLPCGSDRFRGVEYVCC    141 - 210
PPPGTPDPSGTAVGDPSTRSWPPGSRVEGAEDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAV    211 - 280
VGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSKNLPKADRQAL    281 - 350
NEHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRRAALEGFLAALQADPPQAERVLLALRRYLRAE    351 - 420
QKEQRHTLRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLLDQNPHLAQELRPQIQELLHSEHL    421 - 490
GPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKMNPLEQYERKVNASVPRGFPF    491 - 560
HSSEIQRDELAPAGTGVSREAVSGLLIMGAGGGSLIVLSMLLLRRKKPYGAISHGVVEVDPMLTLEEQQL    561 - 630
RELQRHGYENPTYRFLEERP                                                      631 - 650
//

Text Mined References (47)

PMID Year Title