Property Summary

NCBI Gene PubMed Count 43
Grant Count 46
R01 Count 16
Funding $4,105,506.45
PubMed Score 83.91
PubTator Score 61.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (19)

PMID Text
25760599 These data reveal a conserved mechanism for the binding of APP-family proteins to HS and imply a specific regulatory role of HS modifications in the biology of APP and APP-like proteins.
25683482 APLP1 and APLP2, behave similarly to APP in that they both associate with assembled NMDA receptors in the endoplasmic reticulum
24740518 CSF levels of 3 endogenous peptides derived from APLP1 (APL1beta25, APL1beta27 and APL1beta28) were decreased in Down syndrome.
23874953 APLP1 has a regulatory role in the nuclear translocation of APP family intracellular domains due to the sequestration of Fe65.
22178872 APLP1 binds the II-III loop of the Ca(v)2.3 calcium channel and that this binding promotes internalization of the channel.
21952790 [review] APP and its mammalian homologs, amyloid precursor-like proteins APLP1 and APLP2, participate under physiological conditions via trans-cellular dimerization in synaptogenesis.
21574595 The 2.1 A resolution electron density map reveals phosphate ions that are bound to the protein surface. Mutational analysis shows that protein residues interacting with the phosphate ions are also involved in heparin binding.
21178287 Both APLP1 and APLP2, form transcriptionally active triple protein complexes with Mint3 and transcriptional co-activators Taz andYap.
20049724 Human cerebrospinal fluid contains three APLP1-derived Abeta-like peptides that are generated by beta- and gamma-cleavages at a concentration of approximately 4.5 nM.
19401174 neither cell-derived nor chemically synthesized APLP1-derived peptide influences the oligomerization or aggregation of Abeta
More...

AA Sequence

MGPASPAARGLSRRPGQPPLPLLLPLLLLLLRAQPAIGSLAGGSPGAAEAPGSAQVAGLCGRLTLHRDLR      1 - 70
TGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARVEQATQAIPMERWCGGSRSGSCAHPHHQVVPFRC     71 - 140
LPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEACSSQGLILHGSGMLLPCGSDRFRGVEYVCC    141 - 210
PPPGTPDPSGTAVGDPSTRSWPPGSRVEGAEDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAV    211 - 280
VGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSKNLPKADRQAL    281 - 350
NEHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRRAALEGFLAALQADPPQAERVLLALRRYLRAE    351 - 420
QKEQRHTLRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLLDQNPHLAQELRPQIQELLHSEHL    421 - 490
GPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKMNPLEQYERKVNASVPRGFPF    491 - 560
HSSEIQRDELAPAGTGVSREAVSGLLIMGAGGGSLIVLSMLLLRRKKPYGAISHGVVEVDPMLTLEEQQL    561 - 630
RELQRHGYENPTYRFLEERP                                                      631 - 650
//

Text Mined References (46)

PMID Year Title
25760599 2015 Interaction of the amyloid precursor protein-like protein 1 (APLP1) E2 domain with heparan sulfate involves two distinct binding modes.
25683482 2015 APLP1 and APLP2, members of the APP family of proteins, behave similarly to APP in that they associate with NMDA receptors and enhance NMDA receptor surface expression.
24740518 2014 Altered cerebrospinal fluid levels of amyloid ? and amyloid precursor-like protein 1 peptides in Down's syndrome.
23874953 2013 Turnover of amyloid precursor protein family members determines their nuclear signaling capability.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
22178872 2011 APLP1 and Rab5A interact with the II-III loop of the voltage-gated Ca-channel Ca(v)2.3 and modulate its internalization differently.
21952790 2012 Structural aspects and physiological consequences of APP/APLP trans-dimerization.
21574595 2011 The E2 domains of APP and APLP1 share a conserved mode of dimerization.
21293490 2011 Mediator is a transducer of amyloid-precursor-protein-dependent nuclear signalling.
21178287 2011 Signaling via amyloid precursor-like proteins APLP1 and APLP2.
More...