Property Summary

NCBI Gene PubMed Count 230
Grant Count 846
R01 Count 534
Funding $56,008,725.94
PubMed Score 898.27
PubTator Score 243.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
astrocytic glioma 1.100 0.015
osteosarcoma 2.206 0.000
medulloblastoma, large-cell 1.100 0.008
adrenocortical carcinoma -1.004 0.000
group 4 medulloblastoma 1.300 0.000
aldosterone-producing adenoma -1.083 0.008
subependymal giant cell astrocytoma -1.071 0.033
Breast cancer -1.300 0.000
ductal carcinoma in situ -1.200 0.000
invasive ductal carcinoma -1.800 0.000
ovarian cancer -1.100 0.000
pituitary cancer -1.100 0.000

Synonym

Accession P51692 Q8WWS8
Symbols STAT5

Gene

PANTHER Protein Class (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
652026 other 3 / 0 / 22 Late stage assay provider assay for the probe development effort to identify STAT5 inhibitors: luminescence-based cell-based reporter assay to identify inhibitors of STAT5 signaling
652089 summary 0 / 0 / 0 Summary of the probe development effort to identify STAT5 inhibitors: luminescence-based cell-based reporter assay to identify inhibitors of STAT5 signaling

Gene RIF (180)

PMID Text
26917488 Results confirm that STAT5B is mutated in T-PLL and underscore the potential therapeutical relevance of epigenetic regulator.
26717567 The two STAT5 isoforms, STAT5a and STAT5b.
26648017 MSM decreased the ability of STAT5b to bind the promoter of the HER2 gene.
26397390 ABL-N administration induced apoptosis of PC3 cells in a dose-dependent manner, along with the enhanced activity of caspases and increased Bax/Bcl-2 ratio. Expression of KLF5, Stat5b and ICAM-1 was significantly downregulated in PC3 cells.
26362718 support the concept that Jak2-Stat5a/b signaling promotes metastatic progression of prostate cancer by inducing epithelial-to-mesenchymal transition and stem cell properties in prostate cancer cells
26238487 Data indicate direct effects of sorafenib on the Janus kinase JAK1-transcription factors STAT3/5 signaling pathway in immune cells.
26084564 Our study also assessed the regulation of signaling molecules implicated in the growth, progression, differentiation, and migration of cancer cells, such as Jak2, STAT5b, insulin-like growth factor-1Rbeta, and their phosphorylation status
26034074 STAT5B mutations in the heterozygous state have a significant negative impact on height ( approximately 3.9 cm). This effect is milder than the effect seen in the homozygous state, with height usually within the normal range.
25997700 Interference of STAT 5b expression by siRNA targeting enhanced the chemo-sensitivity of gastric cancer cells to gefitinib by promoting mitochondrial pathway-mediated cell apoptosis.
25907517 Expression of STAT5B was significantly correlated with astrocytoma tumor grade and Karnofsky Performance Scale score. High expressions of NPM, p-JAK2, and STAT5B were associated with a short survival time.
More...

AA Sequence

MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQK      1 - 70
KAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQK     71 - 140
HLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVS    141 - 210
LEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCE    211 - 280
KLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAA    281 - 350
TVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS    351 - 420
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATATVLWDNAFAE    421 - 490
PGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNR    491 - 560
ENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIA    561 - 630
WKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYV    631 - 700
KPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVE    701 - 770
ELLGRPMDSQWIPHAQS                                                         771 - 787
//

Text Mined References (244)

PMID Year Title
26917488 2016 Genes encoding members of the JAK-STAT pathway or epigenetic regulators are recurrently mutated in T-cell prolymphocytic leukaemia.
26717567 2015 How Intrinsic Molecular Dynamics Control Intramolecular Communication in Signal Transducers and Activators of Transcription Factor STAT5.
26648017 2016 Methylsulfonylmethane inhibits HER2 expression through STAT5b in breast cancer cells.
26397390 2015 ABL-N may induce apoptosis of human prostate cancer cells through suppression of KLF5, ICAM-1 and Stat5b, and upregulation of Bax/Bcl-2 ratio: An in vitro and in vivo study.
26362718 2015 Jak2-Stat5a/b Signaling Induces Epithelial-to-Mesenchymal Transition and Stem-Like Cell Properties in Prostate Cancer.
26238487 2015 The Raf Kinase Inhibitor Sorafenib Inhibits JAK-STAT Signal Transduction in Human Immune Cells.
26084564 2015 The combination of methylsulfonylmethane and tamoxifen inhibits the Jak2/STAT5b pathway and synergistically inhibits tumor growth and metastasis in ER-positive breast cancer xenografts.
26034074 2015 STAT5B mutations in heterozygous state have negative impact on height: another clue in human stature heritability.
25997700 2015 Interference of STAT 5b expression enhances the chemo-sensitivity of gastric cancer cells to gefitinib by promoting mitochondrial pathway-mediated cell apoptosis.
25907517 2015 Nucleophosmin overexpression is associated with poor survival in astrocytoma.
More...