Property Summary

Ligand Count 4
NCBI Gene PubMed Count 243
PubMed Score 950.47
PubTator Score 243.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -1.004 4.0e-06
aldosterone-producing adenoma -1.025 3.0e-02
astrocytic glioma 1.100 1.5e-02
Breast cancer -1.300 2.8e-12
ductal carcinoma in situ -1.200 7.6e-05
group 4 medulloblastoma 1.300 3.9e-04
invasive ductal carcinoma -1.800 4.5e-04
malignant mesothelioma -1.500 1.1e-06
medulloblastoma, large-cell 1.100 7.7e-03
osteosarcoma 1.786 1.6e-06
ovarian cancer -1.100 6.8e-07
pituitary cancer -1.100 1.7e-05
subependymal giant cell astrocytoma -1.071 3.3e-02

Protein-protein Interaction (1)

Gene RIF (192)

AA Sequence

MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQK      1 - 70
KAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQK     71 - 140
HLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVS    141 - 210
LEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCE    211 - 280
KLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAA    281 - 350
TVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS    351 - 420
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATATVLWDNAFAE    421 - 490
PGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNR    491 - 560
ENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIA    561 - 630
WKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYV    631 - 700
KPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVE    701 - 770
ELLGRPMDSQWIPHAQS                                                         771 - 787
//

Text Mined References (259)

PMID Year Title