Property Summary

NCBI Gene PubMed Count 12
Grant Count 40
R01 Count 18
Funding $4,060,245.16
PubMed Score 129.25
PubTator Score 52.15

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
22820137 ARSD protein level and IGVH were independently associated with the need for therapy of chronic lymphocytic leukemia patients.

AA Sequence

MRSAARRGRAAPAARDSLPVLLFLCLLLKTCEPKTANAFKPNILLIMADDLGTGDLGCYGNNTLRTPNID      1 - 70
QLAEEGVRLTQHLAAAPLCTPSRAAFLTGRHSFRSGMDASNGYRALQWNAGSGGLPENETTFARILQQHG     71 - 140
YATGLIGKWHQGVNCASRGDHCHHPLNHGFDYFYGMPFTLTNDCDPGRPPEVDAALRAQLWGYTQFLALG    141 - 210
ILTLAAGQTCGFFSVSARAVTGMAGVGCLFFISWYSSFGFVRRWNCILMRNHDVTEQPMVLEKTASLMLK    211 - 280
EAVSYIERHKHGPFLLFLSLLHVHIPLVTTSAFLGKSQHGLYGDNVEEMDWLIGKVLNAIEDNGLKNSTF    281 - 350
TYFTSDHGGHLEARDGHSQLGGWNGIYKGGKGMGGWEGGIRVPGIFHWPGVLPAGRVIGEPTSLMDVFPT    351 - 420
VVQLVGGEVPQDRVIDGHSLVPLLQGAEARSAHEFLFHYCGQHLHAARWHQKDSGSVWKVHYTTPQFHPE    421 - 490
GAGACYGRGVCPCSGEGVTHHRPPLLFDLSRDPSEARPLTPDSEPLYHAVIARVGAAVSEHRQTLSPVPQ    491 - 560
QFSMSNILWKPWLQPCCGHFPFCSCHEDGDGTP                                         561 - 593
//

Text Mined References (15)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22820137 Gene expression profiling identifies ARSD as a new marker of disease progression and the sphingolipid metabolism as a potential novel metabolism in chronic lymphocytic leukemia.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699613 2004 Longterm follow-up in chondrodysplasia punctata, tibia-metacarpal type, demonstrating natural history.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11177574 2000 Arylsulfatase D gene in Xp22.3 encodes two protein isoforms.
More...