Property Summary

NCBI Gene PubMed Count 53
Grant Count 87
R01 Count 54
Funding $8,584,037.26
PubMed Score 105.04
PubTator Score 105.71

Knowledge Summary

Patent (39,514)

Expression

Synonym

Accession P51686 Q4VBM3 Q549E0 Q9UQQ6 C-C CKR-9
Symbols GPR28
CDw199
GPR-9-6
CC-CKR-9

Gene

Gene RIF (40)

PMID Text
26879872 Studies indicate important roles played by chemokine ligand 25 (CCL25)/chemokine receptor 9 (CCR9) in tumorigenesis, tumor chemoresistance and metastasis.
26348893 CCR9 and Integrin-beta7 expression has a differential effect on graft fate during acute graft-versus-host disease (GVHD) of the liver depending on the GVHD target tissue.
26279399 CCR9 mRNA and protein levels were significantly increased in the nasopharyngeal carcinoma group compared with the control group.
26168791 CCR9 could be beneficial in predicting lymph node metastasis, and it might act as a novel prognostic biomarker for lung adenocarcinoma.
26006007 We also show that primary tumors can be modeled in immunocompetent mice by microinjecting CCR9-expressing cancer cell lines into early-stage mouse blastocysts, which induces central immune tolerance
25710912 activation of Notch1 has a dominant-negative effect on Ccr9 transcription and that Notch1 and E proteins control the dynamic expression of Ccr9 during T cell development.
25691296 CCR9-CCL25 interaction promoted proliferation and suppressed apoptosis of non-small cell lung cancer cells by activating the PI3K/Akt pathway.
25296976 Expression of CCR9 and CCL25, the only natural ligand of CCR9, was significantly higher (p<0.0001) in NSCLC tissues and serum respectively, compared to their respective controls.
24936795 High CCR9 expression is associated with the pathogenesis of ulcerative colitis.
24870448 The results show the potential of the 91R monoclonal antibody as a therapeutic agent for treatment of CCR9-expressing tumors.
More...

AA Sequence

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVI      1 - 70
LVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCI     71 - 140
SVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKL    141 - 210
KSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTID    211 - 280
AYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRRE    281 - 350
GSLKLSSMLLETTSGALSL                                                       351 - 369
//

Text Mined References (53)

PMID Year Title
26879872 2016 CCR9 in cancer: oncogenic role and therapeutic targeting.
26348893 2015 Differential Effects of Gut-Homing Molecules CC Chemokine Receptor 9 and Integrin-?7 during Acute Graft-versus-Host Disease of the Liver.
26279399 2015 Intracellular expression profile and clinical significance of the CCR9-CCL25 chemokine receptor complex in nasopharyngeal carcinoma.
26168791 2015 Expression of CC chemokine receptor 9 predicts poor prognosis in patients with lung adenocarcinoma.
26006007 2015 Comprehensive models of human primary and metastatic colorectal tumors in immunodeficient and immunocompetent mice by chemokine targeting.
25710912 2015 Repression of Ccr9 transcription in mouse T lymphocyte progenitors by the Notch signaling pathway.
25691296 2015 CCR9-CCL25 interaction suppresses apoptosis of lung cancer cells by activating the PI3K/Akt pathway.
25296976 2014 CCR9/CCL25 expression in non-small cell lung cancer correlates with aggressive disease and mediates key steps of metastasis.
24936795 2014 CCL25/CCR9 interactions regulate the function of iNKT cells in oxazolone-induced colitis in mice.
24870448 Antitumor effects of a monoclonal antibody to human CCR9 in leukemia cell xenografts.
More...