Property Summary

Ligand Count 47
NCBI Gene PubMed Count 48
PubMed Score 145.73
PubTator Score 81.96

Knowledge Summary

Patent (23,134)

TINX Plot

Expression

Protein-protein Interaction (1)

Gene RIF (33)

AA Sequence

MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRSIT      1 - 70
DVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVY     71 - 140
ALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIP    141 - 210
FTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTY    211 - 280
ATHVTEIISFTHCCVNPVIYAFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSS    281 - 350
VDYIL                                                                     351 - 355
//

Text Mined References (50)

PMID Year Title