Property Summary

NCBI Gene PubMed Count 46
Grant Count 45
R01 Count 34
Funding $4,134,887.83
PubMed Score 141.97
PubTator Score 81.96

Knowledge Summary

Patent (23,134)

TINX Plot

Gene RIF (34)

PMID Text
26002980 Epidermal-derived vitamin D3 metabolites and prostaglandins provide an essential cue for the localization of CCR8+ immune surveillance T cells within healthy human skin.
25421818 The coreceptor-binding site in HIV-1 gp120 is centered around an anti-parallel beta-sheet structure 'bridging sheet domain'; mutations in and adjacent to this domain affect the use of coreceptors CCR3 and CCR8 by gp120 for virus entry
25390351 findings suggest that CCR8 expression in ALCL is more closely related to the presence of DUSP22 rearrangements than to cutaneous involvement and that the function of CCR8 may extend beyond its skin-homing properties in this disease
24041034 The coreceptor-binding site in HIV-1 gp120 is centered around an anti-parallel beta-sheet structure 'bridging sheet domain'; mutations in and adjacent to this domain affect the use of coreceptors CCR3 and CCR8 by gp120 for virus entry
24041034 The coreceptor-binding site in HIV-1 gp120 is centered around an anti-parallel beta-sheet structure 'bridging sheet domain'; mutations in and adjacent to this domain affect the use of coreceptors CCR3 and CCR8 by gp120 for virus entry
23999500 Identification of human CCR8 as a CCL18 receptor.
23811304 CCL1-CCR8 interaction may play a critical role in lymphocytic recruitment in IgG4-related sclerosing cholangitis and type 1 autoimmune pancreatitis, leading to duct-centred inflammation and obliterative phlebitis.
23363815 CCR8(+) myeloid cell subset is expanded in patients with cancer.
23043070 Data show that CCR8 expression by newly activated naive T cells is regulated by skin-specific factor(s) derived primarily from epidermal keratinocytes.
22842622 The coreceptor-binding site in HIV-1 gp120 is centered around an anti-parallel beta-sheet structure 'bridging sheet domain'; mutations in and adjacent to this domain affect the use of coreceptors CCR3 and CCR8 by gp120 for virus entry
More...

AA Sequence

MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRSIT      1 - 70
DVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVY     71 - 140
ALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIP    141 - 210
FTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPFNVVLFLTSLHSMHILDGCSISQQLTY    211 - 280
ATHVTEIISFTHCCVNPVIYAFVGEKFKKHLSEIFQKSCSQIFNYLGRQMPRESCEKSSSCQQHSSRSSS    281 - 350
VDYIL                                                                     351 - 355
//

Text Mined References (48)

PMID Year Title
26002980 2015 Skin Metabolites Define a New Paradigm in the Localization of Skin Tropic Memory T Cells.
25390351 2015 Expression of the chemokine receptor gene, CCR8, is associated With DUSP22 rearrangements in anaplastic large cell lymphoma.
23999500 2013 Identification of human CCR8 as a CCL18 receptor.
23811304 2013 Possible involvement of CCL1-CCR8 interaction in lymphocytic recruitment in IgG4-related sclerosing cholangitis.
23363815 2013 Expansion of CCR8(+) inflammatory myeloid cells in cancer patients with urothelial and renal carcinomas.
23043070 2012 Epidermis instructs skin homing receptor expression in human T cells.
22479563 2012 C-terminal clipping of chemokine CCL1/I-309 enhances CCR8-mediated intracellular calcium release and anti-apoptotic activity.
21976223 2011 CCR8 signaling influences Toll-like receptor 4 responses in human macrophages in inflammatory diseases.
20455898 2010 Expression of CCR8 is increased in asthma.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
More...