Property Summary

Ligand Count 44
NCBI Gene PubMed Count 77
PubMed Score 71.15
PubTator Score 313.89

Knowledge Summary

Patent (71,386)

TINX Plot

  Disease (7)

Disease Target Count
Adult T-Cell Lymphoma/Leukemia 30
Disease Target Count
Peripheral T-cell lymphoma 25
Disease Target Count P-value
psoriasis 6694 2.3e-37
ovarian cancer 8520 8.0e-11
lung carcinoma 2843 3.7e-08
medulloblastoma, large-cell 6241 3.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Celiac disease 116 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 3.811 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
lung carcinoma -1.100 3.7e-08
medulloblastoma, large-cell 1.200 3.4e-04
ovarian cancer 1.200 8.0e-11
psoriasis 1.500 2.3e-37

Protein-protein Interaction (1)

Gene RIF (67)

AA Sequence

MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRL      1 - 70
RSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIV     71 - 140
HAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILG    141 - 210
LVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFER    211 - 280
YLDYAIQATETLAFVHCCLNPIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQS    281 - 350
TMDHDLHDAL                                                                351 - 360
//

Text Mined References (78)

PMID Year Title