Property Summary

NCBI Gene PubMed Count 72
Grant Count 236
R01 Count 122
Funding $29,007,547.15
PubMed Score 60.36
PubTator Score 313.89

Knowledge Summary

Patent (71,386)

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.000
lung carcinoma -1.100 0.000
ovarian cancer 1.200 0.000
psoriasis 1.500 0.000

Synonym

Accession P51679 Q9ULY6 Q9ULY7 C-C CKR-4
Symbols CKR4
K5-5
CD194
CMKBR4
ChemR13
CC-CKR-4
HGCN:14099

Gene

  TechDev Info (1)

Gene RIF (62)

PMID Text
26847489 CCR4 mutation is an important determinant of the clinical course in ATLL cases, and that NS and FS mutations of CCR4 behave differently with respect to ATLL pathophysiology.
26683175 CCL22-specific antibodies reveal that engagement of two distinct binding domains on CCL22 is required for CCR4-mediated function.
26093920 Distinctive Treg associated CCR4-CCL22 expression profile with altered frequency of Th17/Treg cell in the immunopathogenesis of Pemphigus Vulgaris.
25790118 Data show that CCR4 was over-expressed in lymph node-negative human gastric cancer tissues and suggest its involvement in promoting tumor invasion probably, through up-regulation of MMP9.
25488980 These findings implicate somatic gain-of-function CCR4 mutations in the pathogenesis of adult T cell leukemia/lymphoma.
25148803 CCR4 C1014T and CCL22 C16A genetic variations were neither associated with the risk, nor with the progression of colorectal cancer in Iranian population
25013801 Higher percentages of CCR4+ CD4 TEM cells in acute RSV infection were accompanied with higher percentages of CXCR3+ CD8 TEM cells, whereas the development of long-lived memory CXCR3+ CD4 and CD8 TCM cells seems to be compromised
24563252 Data show that CCR4 exists in at least two distinct conformations, which are differentially activated by ligand.
24554520 CCR4 has a role in tumor aggressive behavior in renal cell carcinoma
24127572 Anti-CCR4 monoclonal antibody treatment is instrumental for evoking and augmenting antitumor immunity in cancer patients by selectively depleting eTreg cells.
More...

AA Sequence

MNPTDIADTTLDESIYSNYYLYESIPKPCTKEGIKAFGELFLPPLYSLVFVFGLLGNSVVVLVLFKYKRL      1 - 70
RSMTDVYLLNLAISDLLFVFSLPFWGYYAADQWVFGLGLCKMISWMYLVGFYSGIFFVMLMSIDRYLAIV     71 - 140
HAVFSLRARTLTYGVITSLATWSVAVFASLPGFLFSTCYTERNHTYCKTKYSLNSTTWKVLSSLEINILG    141 - 210
LVIPLGIMLFCYSMIIRTLQHCKNEKKNKAVKMIFAVVVLFLGFWTPYNIVLFLETLVELEVLQDCTFER    211 - 280
YLDYAIQATETLAFVHCCLNPIIYFFLGEKFRKYILQLFKTCRGLFVLCQYCGLLQIYSADTPSSSYTQS    281 - 350
TMDHDLHDAL                                                                351 - 360
//

Text Mined References (73)

PMID Year Title
26847489 2016 CCR4 frameshift mutation identifies a distinct group of adult T cell leukaemia/lymphoma with poor prognosis.
26683175 2015 CCL22-specific Antibodies Reveal That Engagement of Two Distinct Binding Domains on CCL22 Is Required for CCR4-mediated Function.
26093920 2015 Distinctive Treg associated CCR4-CCL22 expression profile with altered frequency of Th17/Treg cell in the immunopathogenesis of Pemphigus Vulgaris.
25790118 2015 Aberrant CCR4 expression is involved in tumor invasion of lymph node-negative human gastric cancer.
25488980 2014 Gain-of-function CCR4 mutations in adult T cell leukemia/lymphoma.
25148803 2014 CCR4 C1014T and CCL22 C16A genetic variations in the Iranian patients with colorectal adenocarcinoma.
25013801 2014 The increased type-1 and type-2 chemokine levels in children with acute RSV infection alter the development of adaptive immune responses.
24563252 2014 Distinct conformations of the chemokine receptor CCR4 with implications for its targeting in allergy.
24554520 2014 Expression of chemokine receptor 4 was associated with poor survival in renal cell carcinoma.
24127572 2013 Anti-CCR4 mAb selectively depletes effector-type FoxP3+CD4+ regulatory T cells, evoking antitumor immune responses in humans.
More...