Property Summary

NCBI Gene PubMed Count 26
Grant Count 31
R01 Count 21
Funding $3,720,515.67
PubMed Score 24.19
PubTator Score 45.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

 GO Function (1)

Gene RIF (11)

PMID Text
25224183 findings thus indicate a critical role of correct GPM6A/M6 levels for cognitive function and support a role of the GPM6A duplication for the patient's phenotype
24916915 Data indicate that neuronal membrane glycoproteins GPM6A and GPM6B may act as novel oncogenes in the development of lymphoid leukemia.
23632458 loosing dynamic regulation of neuronal GPM6A expression poses a genetic risk for claustrophobia
23284715 The yeast two-hybrid screen and the coimmunoprecipitation analysis identify the HIV-1 Nef interacting human protein glycoprotein M6A (GPM6A) in cells
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20400778 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19298174 Results suggest that expression level of GPM6A is associated with the differentiation and neuronal migration of neurons derived from undifferentiated human embryonic stem cells.
18574501 Results indicate that M6a modulates mu-opioid receptor endocytosis and post-endocytotic sorting and has an important role in receptor regulation.
18163405 GMP6A plays a role in the stress-induced hippocampal alterations that are found in psychiatric disorders in general and schizophrenia in particular.
More...

AA Sequence

MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFEMARTAGD      1 - 70
TLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLA     71 - 140
WLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELNMT    141 - 210
FHLFIVALAGAGAAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT      211 - 278
//

Text Mined References (29)

PMID Year Title
25224183 2014 Altered GPM6A/M6 dosage impairs cognition and causes phenotypes responsive to cholesterol in human and Drosophila.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24916915 2014 Identification of GPM6A and GPM6B as potential new human lymphoid leukemia-associated oncogenes.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
23632458 2013 A single gene defect causing claustrophobia.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22365631 2012 Genome-wide association study of temperament in bipolar disorder reveals significant associations with three novel Loci.
More...