Property Summary

NCBI Gene PubMed Count 27
PubMed Score 30.27
PubTator Score 45.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.837 2.2e-07
adult high grade glioma -2.300 3.5e-04
aldosterone-producing adenoma -1.269 2.5e-02
astrocytoma -1.200 9.1e-14
Astrocytoma, Pilocytic -1.800 1.6e-05
atypical teratoid / rhabdoid tumor -2.500 3.0e-03
Chronic Lymphocytic Leukemia 1.991 6.9e-04
colon cancer -4.400 9.8e-13
ependymoma -3.000 2.4e-14
glioblastoma -2.100 2.9e-05
interstitial lung disease -2.100 3.6e-02
intraductal papillary-mucinous adenoma (... -2.600 3.4e-03
intraductal papillary-mucinous carcinoma... -2.700 3.3e-03
lung adenocarcinoma -2.700 5.0e-20
lung cancer -2.400 9.7e-04
lung carcinoma -2.400 3.2e-15
medulloblastoma -1.100 2.7e-02
medulloblastoma, large-cell -1.500 2.5e-03
non-small cell lung cancer -3.892 3.6e-40
osteosarcoma -2.003 3.7e-05
ovarian cancer -5.500 7.7e-13
primitive neuroectodermal tumor -2.300 6.0e-03
psoriasis -1.300 1.3e-37
spina bifida 4.189 2.4e-02

Protein-protein Interaction (11)

Gene RIF (12)

AA Sequence

MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFEMARTAGD      1 - 70
TLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLA     71 - 140
WLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELNMT    141 - 210
FHLFIVALAGAGAAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT      211 - 278
//

Text Mined References (30)

PMID Year Title