Property Summary

NCBI Gene PubMed Count 67
PubMed Score 446.50
PubTator Score 59.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.167 2.2e-02
acute quadriplegic myopathy -1.082 9.4e-04
aldosterone-producing adenoma -1.378 6.9e-03
cutaneous lupus erythematosus 1.300 1.7e-02
Duchenne muscular dystrophy -1.004 1.2e-04
group 4 medulloblastoma 1.400 5.7e-04
limb girdle muscular dystrophy 2B -1.155 2.3e-04
malignant mesothelioma -1.100 1.4e-04
ovarian cancer -1.200 2.8e-04
sarcoidosis 1.600 1.2e-02

Synonym

Accession P51668 A6NLF6 A8K786
Symbols SFT
UBCH5
UBC4/5
UBCH5A
E2(17)KB1

Gene

PANTHER Protein Class (1)

PDB

2YHO   5TUT   3OJ4   3PTF   4AP4   2C4P   4QPL   5FER  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (19)

AA Sequence

MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT      1 - 70
TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (72)

PMID Year Title