Property Summary

NCBI Gene PubMed Count 63
Grant Count 45
R01 Count 23
Funding $4,972,472.01
PubMed Score 417.60
PubTator Score 59.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (18)

PMID Text
26502057 Data show that ubiquitin E2 enzymes UBE2D1/2/3 and E3 ligase RNF138 accumulate at DNA-damage sites and act at early resection stages by promoting CtIP protein ubiquitylation and accrual.
25543083 The Asp17 mutation in MDM2 stimulated its discharge of the UBCH5a-ubiquitin thioester adduct.
24709419 The SMURF2:UBCH5 complex is critical in maintaining KRAS protein stability.
24211586 Biochemical characterization of recombinant UBTD1 and UBE2D demonstrated that the two proteins form a stable, stoichiometric complex that can be purified to near homogeneity.
22842904 crystal structure of the dimeric RING domain of rat RNF4 in complex with E2 (UbcH5A) linked by an isopeptide bond to ubiquitin
22438555 These data demonstrate that the ability of ICP0 to interact with cellular E2 ubiquitin-conjugating enzyme UBE2D1 is fundamentally important for its biological functions during HSV-1 infection.
21685362 identify the IDOL-UBE2D complex as an important determinant of LDLR activity, and provide insight into molecular mechanisms underlying the regulation of cholesterol uptake
21396940 This structure reveals an interaction between the ubiquitin surface flanking K11 and residues adjacent to the E2 catalytic cysteine and suggests a possible role for this surface in formation of K11 linkages.
21113135 The authors demonstrate that c-IAP1 and UbcH5 family promote K11-linked polyubiquitination of receptor-interacting protein 1 (RIP1) in vitro and in vivo.
20347421 Whereas UbcH5(A, B and C) is highly efficient in converting IkBa into monoubiquitinated forms, Cdc34 drives ubiquitin (Ub)-Ub conjugation
More...

AA Sequence

MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFT      1 - 70
TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHARE     71 - 140
WTQKYAM                                                                   141 - 147
//

Text Mined References (67)

PMID Year Title
26752685 2016 FIH Regulates Cellular Metabolism through Hydroxylation of the Deubiquitinase OTUB1.
26502057 2015 Systematic E2 screening reveals a UBE2D-RNF138-CtIP axis promoting DNA repair.
25543083 2015 Phosphomimetic mutation of the N-terminal lid of MDM2 enhances the polyubiquitination of p53 through stimulation of E2-ubiquitin thioester hydrolysis.
25416956 2014 A proteome-scale map of the human interactome network.
24709419 2014 KRAS protein stability is regulated through SMURF2: UBCH5 complex-mediated ?-TrCP1 degradation.
24211586 2014 The UbL protein UBTD1 stably interacts with the UBE2D family of E2 ubiquitin conjugating enzymes.
23509263 2013 Activity-enhancing mutations in an E3 ubiquitin ligase identified by high-throughput mutagenesis.
22842904 2012 Structure of a RING E3 ligase and ubiquitin-loaded E2 primed for catalysis.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
22438555 2012 Functional characterization of residues required for the herpes simplex virus 1 E3 ubiquitin ligase ICP0 to interact with the cellular E2 ubiquitin-conjugating enzyme UBE2D1 (UbcH5a).
More...