Property Summary

NCBI Gene PubMed Count 59
Grant Count 2
Funding $54,000
PubMed Score 13.02
PubTator Score 12.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 2.000 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.009
lung cancer 1.100 0.000
ovarian cancer 1.900 0.001

Synonym

Accession P51665 D3DWS9 Q6PKI2 Q96E97
Symbols P40
S12
Rpn8
MOV34

Gene

 Grant Application (2)

PDB

5GJQ   5GJR   5L4K   2O95   2O96  

 MGI Term (1)

Gene RIF (35)

PMID Text
22190034 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20643764 SNP rs17336700 of a non-MHC ubiquitin-proteasome subunit PSMD7 is significantly associated with ankylosing spondylitis in Chinese population and the mRNA level of the PSMD7 gene in liver tissue increased when the rs17336700 C allele was present.
20643764 Observational study of gene-disease association. (HuGE Navigator)
19844255 Observational study of gene-disease association. (HuGE Navigator)
17559875 although the MPN domain of Mov34 shows a typical metalloprotease fold, it is unable to coordinate a metal ion.
16842755 MPN domain of Mov34 is highly resistant to proteolysis
15221960 data suggest a differential nuclear function of modified and unmodified S12 in cancer
14614829 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14564014 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
14557625 HIV-1 gp120 is identified to have a physical interaction with proteasome 26S subunit, non-ATPase, 7 (PSMD7) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
More...

AA Sequence

MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFL      1 - 70
DHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYIS     71 - 140
VEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRS    141 - 210
YLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKI    211 - 280
ANRDAEKKEGQEKEESKKDRKEDKEKDKDKEKSDVKKEEKKEKK                              281 - 324
//

Text Mined References (63)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25389016 2014 ADAR1 enhances HTLV-1 and HTLV-2 replication through inhibition of PKR activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22078707 2011 TRIM5? associates with proteasomal subunits in cells while in complex with HIV-1 virions.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20643764 2011 A polymorphism rs17336700 in the PSMD7 gene is associated with ankylosing spondylitis in Chinese subjects.
More...