Property Summary

NCBI Gene PubMed Count 59
PubMed Score 13.12
PubTator Score 12.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.4e-05
psoriasis 6694 3.0e-05
lung cancer 4740 4.6e-04
intraductal papillary-mucinous neoplasm (IPMN) 3291 8.5e-03
Disease Target Count Z-score Confidence
Hereditary renal cell carcinoma 3 4.216 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 8.5e-03
lung cancer 1.100 4.6e-04
ovarian cancer -1.200 2.4e-05
psoriasis 2.000 3.0e-05

Synonym

Accession P51665 D3DWS9 Q6PKI2 Q96E97
Symbols P40
S12
Rpn8
MOV34

Gene

PANTHER Protein Class (3)

PDB

5GJQ   5GJR   5LN3   5M32   5T0C   5T0G   5T0H   5T0I   5T0J   5VGZ   5VHF   5VHH   5VHI   5VHS   5L4K   2O95   2O96  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (32)

AA Sequence

MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFL      1 - 70
DHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYIS     71 - 140
VEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRS    141 - 210
YLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKI    211 - 280
ANRDAEKKEGQEKEESKKDRKEDKEKDKDKEKSDVKKEEKKEKK                              281 - 324
//

Text Mined References (66)

PMID Year Title