Property Summary

NCBI Gene PubMed Count 59
PubMed Score 13.12
PubTator Score 12.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.4e-05
psoriasis 6694 3.0e-05
lung cancer 4740 4.6e-04
intraductal papillary-mucinous neoplasm (IPMN) 3291 8.5e-03
Disease Target Count Z-score Confidence
Hereditary renal cell carcinoma 3 4.216 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 8.5e-03
lung cancer 1.100 4.6e-04
ovarian cancer -1.200 2.4e-05
psoriasis 2.000 3.0e-05

 MGI Phenotype (1)

PDB (17)

Gene RIF (32)

AA Sequence

MPELAVQKVVVHPLVLLSVVDHFNRIGKVGNQKRVVGVLLGSWQKKVLDVSNSFAVPFDEDDKDDSVWFL      1 - 70
DHDYLENMYGMFKKVNARERIVGWYHTGPKLHKNDIAINELMKRYCPNSVLVIIDVKPKDLGLPTEAYIS     71 - 140
VEEVHDDGTPTSKTFEHVTSEIGAEEAEEVGVEHLLRDIKDTTVGTLSQRITNQVHGLKGLNSKLLDIRS    141 - 210
YLEKVATGKLPINHQIIYQLQDVFNLLPDVSLQEFVKAFYLKTNDQMVVVYLASLIRSVVALHNLINNKI    211 - 280
ANRDAEKKEGQEKEESKKDRKEDKEKDKDKEKSDVKKEEKKEKK                              281 - 324
//

Text Mined References (66)

PMID Year Title