Property Summary

Ligand Count 3
NCBI Gene PubMed Count 47
PubMed Score 168.41
PubTator Score 121.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.0
Disease Target Count Z-score Confidence
Peroneal nerve paralysis 11 3.492 1.7
Paraplegia 74 3.28 1.6

Expression

  Differential Expression (19)

Disease log2 FC p
active ulcerative colitis -1.019 4.5e-02
adrenocortical carcinoma -1.026 2.9e-02
adult high grade glioma -1.600 5.1e-04
astrocytic glioma 1.200 2.1e-02
atypical teratoid / rhabdoid tumor -1.400 6.9e-06
Chronic Lymphocytic Leukemia 1.619 1.2e-03
cystic fibrosis -1.585 1.7e-04
gastric cancer 1.200 1.5e-02
glioblastoma -1.800 4.6e-02
interstitial cystitis -1.300 3.2e-02
medulloblastoma -1.300 3.1e-03
medulloblastoma, large-cell -2.600 1.6e-05
oligodendroglioma 1.600 2.0e-03
osteosarcoma -2.983 2.7e-03
ovarian cancer 1.200 7.7e-03
pancreatic ductal adenocarcinoma liver m... -2.279 6.2e-03
pituitary cancer 1.200 7.8e-05
primary Sjogren syndrome 1.300 4.7e-04
Waldenstrons macroglobulinemia 1.045 1.3e-02

 GWAS Trait (1)

Gene RIF (31)

AA Sequence

MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLRTDSFVGGRWL      1 - 70
PAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKERSSLLRKWYNLMIQNKDDLAR     71 - 140
IITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM    141 - 210
ITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKI    211 - 280
SFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQR    281 - 350
GIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFF    351 - 420
EPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMV    421 - 490
GVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL                             491 - 535
//

Text Mined References (50)

PMID Year Title