Property Summary

NCBI Gene PubMed Count 91
PubMed Score 254.17
PubTator Score 146.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Rheumatoid arthritis 1191
Disease Target Count Z-score Confidence
Rabies 20 4.365 2.2
Glaucoma 239 4.27 2.1
Bronchiolitis 18 3.363 1.7
Cancer 2499 3.078 1.5

Expression

  Differential Expression (32)

Disease log2 FC p
active Crohn's disease 1.463 4.7e-03
astrocytic glioma -1.300 3.2e-02
Astrocytoma, Pilocytic 2.700 2.4e-08
atypical teratoid / rhabdoid tumor -1.400 8.0e-03
autosomal dominant Emery-Dreifuss muscul... 1.148 1.6e-02
Breast cancer -3.700 9.1e-25
breast carcinoma -1.700 6.1e-04
colon cancer -1.500 8.6e-03
dermatomyositis 1.200 2.9e-02
Duchenne muscular dystrophy 1.262 1.3e-05
ductal carcinoma in situ -2.600 6.6e-05
glioblastoma 1.600 3.0e-04
group 4 medulloblastoma -2.000 8.8e-05
Hydrolethalus syndrome 1.502 4.9e-02
interstitial lung disease -1.500 2.5e-02
intraductal papillary-mucinous carcinoma... -1.500 4.9e-02
invasive ductal carcinoma -3.800 4.3e-05
juvenile dermatomyositis 1.266 1.0e-07
lung adenocarcinoma -1.900 1.5e-14
lung cancer -4.600 2.5e-06
lung carcinoma -3.200 2.4e-25
malignant mesothelioma 1.100 2.8e-06
medulloblastoma, large-cell -2.300 5.4e-05
non-small cell lung cancer -2.710 2.7e-26
oligodendroglioma -1.400 1.5e-02
ovarian cancer -3.800 5.8e-08
pancreatic cancer 1.100 3.5e-03
pancreatic carcinoma 1.100 3.5e-03
pediatric high grade glioma 1.100 2.1e-02
pituitary cancer -1.300 4.2e-04
spina bifida -1.500 4.1e-02
ulcerative colitis 1.500 7.7e-04

 IMPC Phenotype (1)

Gene RIF (48)

AA Sequence

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVW      1 - 70
ICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVI     71 - 140
IAPLCTSVGRCFSSVSLQLSQD                                                    141 - 162
//

Text Mined References (96)

PMID Year Title