Property Summary

NCBI Gene PubMed Count 89
PubMed Score 245.86
PubTator Score 146.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
breast carcinoma 1614 2.10279452209916E-35
non-small cell lung cancer 2798 2.70560272206E-26
lung carcinoma 2844 2.39866098108664E-25
Breast cancer 3099 9.14141934887973E-25
lung adenocarcinoma 2714 3.59353449283657E-11
pilocytic astrocytoma 3086 2.71891457692682E-9
ovarian cancer 8492 5.79974716944091E-8
juvenile dermatomyositis 1189 1.00993413917393E-7
lung cancer 4473 1.79647493666372E-7
malignant mesothelioma 3163 2.80226456450301E-6
medulloblastoma, large-cell 6234 6.0333677639816E-6
Duchenne muscular dystrophy 602 3.41591179718662E-5
invasive ductal carcinoma 2950 4.3382110548725E-5
ulcerative colitis 2087 4.73465294258239E-5
ductal carcinoma in situ 1745 6.6327416414163E-5
group 4 medulloblastoma 1875 8.83991055012364E-5
pediatric high grade glioma 2712 1.28434696544693E-4
pituitary cancer 1972 4.1852282156588E-4
pancreatic cancer 2300 0.00163654243665091
pancreatic carcinoma 567 0.00163654243665091
active Crohn's disease 918 0.00466809040209351
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00756526171990749
atypical teratoid / rhabdoid tumor 4369 0.00796998933189974
colon cancer 1475 0.00856131748915909
glioblastoma 5572 0.00946192213247509
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0108153006830237
oligodendroglioma 2849 0.0145742941559201
interstitial lung disease 292 0.0252047455285045
dermatomyositis 967 0.0292029296960358
astrocytic glioma 2241 0.0317114103772714
spina bifida 1064 0.0407586488378292
Hydrolethalus syndrome 128 0.0491523828186899
Disease Target Count Z-score Confidence
Rabies 19 4.403 2.2
Glaucoma 135 4.072 2.0
Bronchiolitis 9 3.383 1.7
Cancer 2346 3.057 1.5

Expression

  Differential Expression (32)

Synonym

Accession P51636 A4D0U2 Q9UGM7
Symbols CAV

Gene

  Ortholog (9)

Gene RIF (47)

PMID Text
26543085 CAV-1 and -2 have roles in progression of prostate neoplasms
26480297 Caveolin-2 expression is necessary for the control of E2-dependent cellular proliferation of MCF-7 cells.
26047157 variant in CAV2 is associated with increased age-of-onset of P. aeruginosa airway infection in cystic fibrosis cohort.
26015768 The minor allele G of rs17588172 in the CAV1-CAV2 locus is associated with decreased expression of CAV1 and CAV2 in some tissues, marginally with intraocular pressure elevation, and consequently with increased susceptibility to high-tension glaucoma.
25556234 Results present initial characterization of key proteins Cav2 and CFL1 as cellular factors that colocalize with M in viral inclusions and filaments and ZNF502 protein which appears to interact with RSV M in the nucleus.
25525164 The implication of the caveolin genes, CAV1/CAV2, as a common genetic factor influencing both IOP variations and POAG may provide new insights of the underlying mechanism leading to glaucoma and glaucomatous visual field loss.
24572674 CAV1/CAV2 SNPs were associated significantly with primary open-angle glaucoma overall, particularly among women.
24034151 This meta-analysis suggests that rs4236601[A] is associated with increased risk for POAG in Caucasian and Asian populations.
23743525 Our findings did not correspond with previous positive results, suggesting that CAV1-CAV2 variants studied in the present study are not important risk factors for Normal Tension Glaucoma.
23667606 This study does not support an association between CAV2 variation and kidney transplant survival.
More...

AA Sequence

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVW      1 - 70
ICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVI     71 - 140
IAPLCTSVGRCFSSVSLQLSQD                                                    141 - 162
//

Text Mined References (94)

PMID Year Title
26543085 Significant Association of Caveolin-1 and Caveolin-2 with Prostate Cancer Progression.
26480297 2016 Modulation of 17?-Estradiol Signaling on Cellular Proliferation by Caveolin-2.
26047157 2015 Exome Sequencing of Phenotypic Extremes Identifies CAV2 and TMC6 as Interacting Modifiers of Chronic Pseudomonas aeruginosa Infection in Cystic Fibrosis.
26015768 2015 Expression-associated polymorphisms of CAV1-CAV2 affect intraocular pressure and high-tension glaucoma risk.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
25525164 2014 Exome array analysis identifies CAV1/CAV2 as a susceptibility locus for intraocular pressure.
25173106 2014 Genome-wide analysis of multi-ancestry cohorts identifies new loci influencing intraocular pressure and susceptibility to glaucoma.
25173105 2014 Common variants near ABCA1, AFAP1 and GMDS confer risk of primary open-angle glaucoma.
25035420 2014 Identification of three novel genetic variations associated with electrocardiographic traits (QRS duration and PR interval) in East Asians.
24572674 2014 Association of CAV1/CAV2 genomic variants with primary open-angle glaucoma overall and by gender and pattern of visual field loss.
More...