Property Summary

NCBI Gene PubMed Count 174
Grant Count 196
R01 Count 153
Funding $12,708,538.42
PubMed Score 320.43
PubTator Score 242.31

Knowledge Summary

Patent (10,866)

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis 1.600 0.000
astrocytoma 1.900 0.001
glioblastoma 1.800 0.001
atypical teratoid / rhabdoid tumor 1.200 0.003
medulloblastoma, large-cell 1.300 0.000
acute quadriplegic myopathy 1.301 0.000
lung cancer 1.300 0.006
colon cancer 1.800 0.014
pediatric high grade glioma 1.400 0.001
non primary Sjogren syndrome sicca 1.300 0.035
inflammatory breast cancer 1.200 0.013
ovarian cancer 2.100 0.000

Synonym

Accession P51617 D3DWW3 D3DWW4 Q7Z5V4 Q96C06 Q96RL2 IRAK-1
Symbols IRAK
pelle

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (122)

PMID Text
26527316 Our findings reveal that IRAK1 promotes cell survival and is an attractive therapeutic target in head and neck squamous cell carcinomas
26503059 IRAK1 overexpression drive aggressive growth, metastasis and acquired resistance to paclitaxel treatment in breast cancer.
26151128 miR146a has an important promoting effect on the apoptosis of granulosa cells by targeting IRAK1 and TRAF6 via the caspase cascade pathway
26142671 These data demonstrated that these three single nucleotide polymorphisms (rs3027898, rs1059702, rs1059703) in IRAK1 were associated with autoimmune diseases risk.
26075815 This is the first study to show an association between single nucleotide polymorphisms in IRAK1, IRAK4 and MyD88, and the presence of severe invasive pneumococcal disease.
25955717 Data suggest that TLR2 (toll like receptor 2) is down-regulated by microRNA-UL112-3p from human Cytomegalovirus; microRNA-UL112-3p also down-regulates TLR2-induced post-translational activation of IRAK1 signaling.
25922567 Src, Syk, IRAK1, and IRAK4 have roles in anti-inflammatory responses mediated by dietary flavonoid Kaempferol
25550857 expression of IRAK1 in lung cancer was significantly higher compared with that in normal lung tissues and was correlated with TNM stage, lymphatic metastasis and tumor size.
25505246 MicroRNA-146a and microRNA-146b regulate human dendritic cell apoptosis and cytokine production by targeting TRAF6 and IRAK1 proteins.
25472883 HIV-1 Tat specifically associates with IRAK1 promoter to downregulate IRAK1 expression in T cells
More...

AA Sequence

MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVL      1 - 70
WPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSAS     71 - 140
TFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPFPFCWPLCEISRGTH    141 - 210
NFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQ    211 - 280
NGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDE    281 - 350
RLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG    351 - 420
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELG    421 - 490
LGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPPSPQENSYVSSTGRAHSGAAP    491 - 560
WQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESS    561 - 630
WGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQD    631 - 700
RQGPEESDEFQS                                                              701 - 712
//

Text Mined References (187)

PMID Year Title
26527316 2015 IRAK1 is a novel DEK transcriptional target and is essential for head and neck cancer cell survival.
26503059 2015 IRAK1 is a therapeutic target that drives breast cancer metastasis and resistance to paclitaxel.
26151128 2015 Downregulation of microRNA?146a inhibits ovarian granulosa cell apoptosis by simultaneously targeting interleukin?1 receptor?associated kinase and tumor necrosis factor receptor?associated factor 6.
26142671 2015 Susceptibility of autoimmune diseases in three polymorphisms of infection-associated gene IRAK1.
26075815 2015 Association of Polymorphisms in IRAK1, IRAK4 and MyD88, and Severe Invasive Pneumococcal Disease.
25955717 2015 Human Cytomegalovirus miR-UL112-3p Targets TLR2 and Modulates the TLR2/IRAK1/NF?B Signaling Pathway.
25922567 2015 The dietary flavonoid Kaempferol mediates anti-inflammatory responses via the Src, Syk, IRAK1, and IRAK4 molecular targets.
25550857 2014 Expression of IRAK1 in lung cancer tissues and its clinicopathological significance: a microarray study.
25505246 2015 MicroRNA-146a and microRNA-146b regulate human dendritic cell apoptosis and cytokine production by targeting TRAF6 and IRAK1 proteins.
25458699 2015 Variants in IRAK1-MECP2 region confer susceptibility to autoimmune thyroid diseases.
More...