Property Summary

NCBI Gene PubMed Count 29
Grant Count 6
Funding $287,894.92
PubMed Score 33.46
PubTator Score 38.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis -1.700 0.013
osteosarcoma 1.364 0.000
glioblastoma 1.800 0.000
medulloblastoma, large-cell 1.200 0.000
pediatric high grade glioma 1.200 0.001
subependymal giant cell astrocytoma 1.565 0.012

 GWAS Trait (1)

Gene RIF (10)

PMID Text
24043878 rs2269372 in RENBP was associated with risk of schizophrenia in a Han Chinese population.
23969252 several SNPs and haplotypes of the RnBP gene are associated with either increased or decreased risk of developing essential hypertension.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20486282 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
12612874 gene and protein expression were selectively activated in left ventricular myocytes from end-stage failing human hearts
12499362 determination of catabolic role in sialic acid metabolism
12446192 Observational study of gene-disease association. (HuGE Navigator)
12394950 Observational study of gene-disease association. (HuGE Navigator)
11926999 domain structure of RBP

AA Sequence

MSKGLPARQDMEKERETLQAWKERVGQELDRVVAFWMEHSHDQEHGGFFTCLGREGRVYDDLKYVWLQGR      1 - 70
QVWMYCRLYRTFERFRHAQLLDAAKAGGEFLLRYARVAPPGKKCAFVLTRDGRPVKVQRTIFSECFYTMA     71 - 140
MNELWRATGEVRYQTEAVEMMDQIVHWVQEDASGLGRPQLQGAPAAEPMAVPMMLLNLVEQLGEADEELA    141 - 210
GKYAELGDWCARRILQHVQRDGQAVLENVSEGGKELPGCLGRQQNPGHTLEAGWFLLRHCIRKGDPELRA    211 - 280
HVIDKFLLLPFHSGWDPDHGGLFYFQDADNFCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFY    281 - 350
QVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGCFHVPRCLAMCEEMLGALLSRPAPAPSPAPT    351 - 420
PACRGAE                                                                   421 - 427
//

Text Mined References (31)

PMID Year Title
24043878 2014 Common variants on Xq28 conferring risk of schizophrenia in Han Chinese.
23969252 2013 Association of renin binding protein (RnBP) gene polymorphisms with essential hypertension in the Hani minority of southwestern China.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22692205 2012 Metabolism of vertebrate amino sugars with N-glycolyl groups: elucidating the intracellular fate of the non-human sialic acid N-glycolylneuraminic acid.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20486282 2010 Genetic variants in the renin-angiotensin-aldosterone system and salt sensitivity of blood pressure.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...