Property Summary

NCBI Gene PubMed Count 94
Grant Count 50
R01 Count 32
Funding $5,434,920.09
PubMed Score 133.35
PubTator Score 127.90

Knowledge Summary

Patent

No data available

Expression

Gene RIF (94)

PMID Text
26972388 Data suggest that antiarrhythmic prodrugs amiodarone and dronedarone are extensively metabolized by CYP2J2; specific CYP2J2 metabolites include N-desbutyldronedarone and N-desethylamiodarone, potent [reversible/irreversible] inhibitors of CYP2J2.
26334592 Here we present the detection of substrate binding to cytochrome P450-2J2 (CYP2J2), the predominant P450 in the human heart, using a combination of Nanodisc technology and a nanohole plasmonic sensor
26209360 Tanshinone IIA exerts its anticancer effect by inhibiting CYP2J2 activity in HepG2 cells.
25796175 The CYP2J2 rs890293 T allele and GT+TT genotype were significantly associated with an increased risk of late onset Alzheimer disease.
25686540 CYP2J2 and EETs prevent cardiac fibrosis and cardiac dysfunction by suppressing transmission of pro-inflammation from cardiomyocytes to macrophages in heart
25601761 CYP2J2 expression showed significant upregulation (P<0.05) during Cy treatment before stem cell transplantation
25560582 Our results suggest that individuals with any conventional risk factor for MI along with CYP2J2*7 variant allele may be predisposed to risk of myocardial infarct in South Indian population
25406731 The present study shows that elevated EET levels in BC tissues are associated with upregulation of CYP2C8, 2C9, and 2J2, and downregulation of sEH, and are also associated with aggressive cell behavior in BC patients.
25389363 Data suggest that up-regulation of CYP2J2 activity can attenuate type 2 diabetes and improve insulin resistance via down-regulation of NFkappaB and MAPK signaling pathways and up-regulation of PPARgamma.
25388680 Patients with CYP2C8*2C and EPHX2 404del variants had worse long-term outcomes while those with EPHX2 287Gln, CYP2J2*7, and CYP2C9 g.816G variants had favorable outcomes.
More...

AA Sequence

MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVDFEQSHLEVQL      1 - 70
FVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRF     71 - 140
TLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQ    141 - 210
LLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDA    211 - 280
YLKEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQ    281 - 350
PSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT    351 - 420
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITIS    421 - 490
PVSHRLCAVPQV                                                              491 - 502
//

Text Mined References (95)

PMID Year Title
26972388 2016 Multiple modes of inhibition of human cytochrome P450 2J2 by dronedarone, amiodarone and their active metabolites.
26334592 2016 Substrate binding to cytochrome P450-2J2 in Nanodiscs detected by nanoplasmonic Lycurgus cup arrays.
26209360 2015 Inhibition of cytochrome P450 2J2 by tanshinone IIA induces apoptotic cell death in hepatocellular carcinoma HepG2 cells.
25796175 2015 CYP2J2 rs890293 polymorphism is associated with susceptibility to Alzheimer's disease in the Chinese Han population.
25686540 CYP epoxygenase 2J2 prevents cardiac fibrosis by suppression of transmission of pro-inflammation from cardiomyocytes to macrophages.
25601761 2015 Cytochrome P450 2J2, a new key enzyme in cyclophosphamide bioactivation and a potential biomarker for hematological malignancies.
25560582 2015 Association of CYP2C8, CYP2C9 and CYP2J2 gene polymorphisms with myocardial infarction in South Indian population.
25406731 2014 Elevated 14,15- epoxyeicosatrienoic acid by increasing of cytochrome P450 2C8, 2C9 and 2J2 and decreasing of soluble epoxide hydrolase associated with aggressiveness of human breast cancer.
25389363 2015 CYP2J2 attenuates metabolic dysfunction in diabetic mice by reducing hepatic inflammation via the PPAR?.
25388680 2015 Genetic markers in the EET metabolic pathway are associated with outcomes in patients with aneurysmal subarachnoid hemorrhage.
More...