Property Summary

NCBI Gene PubMed Count 94
PubMed Score 133.35
PubTator Score 127.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 8.37814726451531E-82
atypical teratoid/rhabdoid tumor 1095 2.78635639767301E-12
medulloblastoma, large-cell 6234 5.56139793068042E-7
group 3 medulloblastoma 2254 6.12966857607386E-7
posterior fossa group A ependymoma 1511 6.68033774504393E-7
interstitial cystitis 2299 5.30405835824238E-6
pediatric high grade glioma 2712 7.35531610924092E-5
Atopic dermatitis 944 9.58475086473992E-5
lung cancer 4473 1.14473256399711E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.12513423645037E-4
primitive neuroectodermal tumor 3031 5.60726483746565E-4
glioblastoma 5572 7.31273796309656E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00100938831292597
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00309592775023154
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0207903185741652
spina bifida 1064 0.0303963760645672
oligodendroglioma 2849 0.0307901303292466
ductal carcinoma in situ 1745 0.0327046149610136
cystic fibrosis and chronic rhinosinusitis 213 0.0350003198510362
chronic rhinosinusitis 512 0.0352861035251954
Disease Target Count Z-score Confidence
Hypertension 293 3.419 1.7

Expression

Synonym

Accession P51589 B2RD33 Q8TF13
Symbols CPJ2
CYPIIJ2

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum OMA EggNOG
Opossum OMA Inparanoid
Platypus OMA EggNOG

Gene RIF (94)

PMID Text
26972388 Data suggest that antiarrhythmic prodrugs amiodarone and dronedarone are extensively metabolized by CYP2J2; specific CYP2J2 metabolites include N-desbutyldronedarone and N-desethylamiodarone, potent [reversible/irreversible] inhibitors of CYP2J2.
26334592 Here we present the detection of substrate binding to cytochrome P450-2J2 (CYP2J2), the predominant P450 in the human heart, using a combination of Nanodisc technology and a nanohole plasmonic sensor
26209360 Tanshinone IIA exerts its anticancer effect by inhibiting CYP2J2 activity in HepG2 cells.
25796175 The CYP2J2 rs890293 T allele and GT+TT genotype were significantly associated with an increased risk of late onset Alzheimer disease.
25686540 CYP2J2 and EETs prevent cardiac fibrosis and cardiac dysfunction by suppressing transmission of pro-inflammation from cardiomyocytes to macrophages in heart
25601761 CYP2J2 expression showed significant upregulation (P<0.05) during Cy treatment before stem cell transplantation
25560582 Our results suggest that individuals with any conventional risk factor for MI along with CYP2J2*7 variant allele may be predisposed to risk of myocardial infarct in South Indian population
25406731 The present study shows that elevated EET levels in BC tissues are associated with upregulation of CYP2C8, 2C9, and 2J2, and downregulation of sEH, and are also associated with aggressive cell behavior in BC patients.
25389363 Data suggest that up-regulation of CYP2J2 activity can attenuate type 2 diabetes and improve insulin resistance via down-regulation of NFkappaB and MAPK signaling pathways and up-regulation of PPARgamma.
25388680 Patients with CYP2C8*2C and EPHX2 404del variants had worse long-term outcomes while those with EPHX2 287Gln, CYP2J2*7, and CYP2C9 g.816G variants had favorable outcomes.
More...

AA Sequence

MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVDFEQSHLEVQL      1 - 70
FVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHIFKKNGLIMSSGQAWKEQRRF     71 - 140
TLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDPHFKINNAVSNIICSITFGERFEYQDSWFQQ    141 - 210
LLKLLDEVTYLEASKTCQLYNVFPWIMKFLPGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDA    211 - 280
YLKEMSKHTGNPTSSFHEENLICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQ    281 - 350
PSTAARESMPYTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT    351 - 420
FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLSLKFRMGITIS    421 - 490
PVSHRLCAVPQV                                                              491 - 502
//

Text Mined References (95)

PMID Year Title
26972388 2016 Multiple modes of inhibition of human cytochrome P450 2J2 by dronedarone, amiodarone and their active metabolites.
26334592 2016 Substrate binding to cytochrome P450-2J2 in Nanodiscs detected by nanoplasmonic Lycurgus cup arrays.
26209360 2015 Inhibition of cytochrome P450 2J2 by tanshinone IIA induces apoptotic cell death in hepatocellular carcinoma HepG2 cells.
25796175 2015 CYP2J2 rs890293 polymorphism is associated with susceptibility to Alzheimer's disease in the Chinese Han population.
25686540 CYP epoxygenase 2J2 prevents cardiac fibrosis by suppression of transmission of pro-inflammation from cardiomyocytes to macrophages.
25601761 2015 Cytochrome P450 2J2, a new key enzyme in cyclophosphamide bioactivation and a potential biomarker for hematological malignancies.
25560582 2015 Association of CYP2C8, CYP2C9 and CYP2J2 gene polymorphisms with myocardial infarction in South Indian population.
25406731 2014 Elevated 14,15- epoxyeicosatrienoic acid by increasing of cytochrome P450 2C8, 2C9 and 2J2 and decreasing of soluble epoxide hydrolase associated with aggressiveness of human breast cancer.
25389363 2015 CYP2J2 attenuates metabolic dysfunction in diabetic mice by reducing hepatic inflammation via the PPAR?.
25388680 2015 Genetic markers in the EET metabolic pathway are associated with outcomes in patients with aneurysmal subarachnoid hemorrhage.
More...