Property Summary

NCBI Gene PubMed Count 250
PubMed Score 171.75
PubTator Score 911.77

Knowledge Summary


No data available


  Disease Sources (4)


  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.026
ependymoma -1.400 0.041
oligodendroglioma -1.400 0.025
psoriasis -2.800 0.000
osteosarcoma -1.428 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.400 0.000
sonic hedgehog group medulloblastoma -1.200 0.001
medulloblastoma, large-cell -1.700 0.000
pancreatic ductal adenocarcinoma liver m... -1.581 0.000
adult high grade glioma -1.400 0.000



2BZG   2H11  

  Ortholog (12)

Gene RIF (250)

27333713 The most frequently occurring nonfunctional TPMT allele in Croatian population is TPMT*3A. Variant genotypes were statistically significantly more common in Crohn's disease subgroup than in ulcerative colitis subgroup.
26633017 Association of TPMT polymorphisms with overall azathioprine-induced adverse drug reactions, bone marrow toxicity and gastric intolerance, but not with hepatotoxicity (meta-analysis).
26411491 The TPMT promoter region may serve as a pharmacogenomic biomarker when introducing thiopurine therapy
26410243 structure-function relationships of TPMT
26072396 Identification of TPMT variants and subsequent dose reduction reduces hematologic events during thiopurine treatment of inflammatory bowel disease.
25940902 refinements in risk stratification and treatment have reduced the influence of TPMT genotype on treatment outcome in a contemporary protocol.
25819542 We report on the presence of the TPMT*3C and *3A mutant alleles in the Libyan population. Therefore, monitoring the patients to be treated with doses of thiopurine drugs for TPMT variants is worthwhile to avoid the development of severe myelosuppression.
25799415 association of TPMT polymorphisms with overall thiopurine-induced adverse drug reactions
25564374 Results show complete sequence-based screening study evaluating all TPMT variants in Asian populations some of them may ne of relevance in Korean population.
25551397 this paper shows that the influence of TPMT and COMT on the development of cisplatin-induced hearing loss may be less important than previously suggested.

AA Sequence

ICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK                                       211 - 245

Text Mined References (258)

PMID Year Title
26633017 2015 Association between Thiopurine S-Methyltransferase Polymorphisms and Azathioprine-Induced Adverse Drug Reactions in Patients with Autoimmune Diseases: A Meta-Analysis.
26411491 2015 TPMT gene expression is increased during maintenance therapy in childhood acute lymphoblastic leukemia patients in a TPMT gene promoter variable number of tandem repeat-dependent manner.
26410243 2015 Structural and functional impact of missense mutations in TPMT: An integrated computational approach.
26072396 2015 Identification of Patients With Variants in TPMT and Dose Reduction Reduces Hematologic Events During Thiopurine Treatment of Inflammatory Bowel Disease.
25940902 2015 Thiopurine methyltransferase and treatment outcome in the UK acute lymphoblastic leukaemia trial ALL2003.
25819542 2015 Polymorphisms of the thiopurine S-methyltransferase gene among the Libyan population.
25799415 2015 Association between thiopurine S-methyltransferase polymorphisms and thiopurine-induced adverse drug reactions in patients with inflammatory bowel disease: a meta-analysis.
25564374 2015 Complete sequence-based screening of TPMT variants in the Korean population.
25551397 2014 Influence of genetic variants in TPMT and COMT associated with cisplatin induced hearing loss in patients with cancer: two new cohorts and a meta-analysis reveal significant heterogeneity between cohorts.