Property Summary

Ligand Count 1
NCBI Gene PubMed Count 262
PubMed Score 165.61
PubTator Score 911.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.400 2.6e-05
astrocytic glioma -1.400 2.6e-02
atypical teratoid / rhabdoid tumor -1.800 1.8e-10
ependymoma -1.400 4.1e-02
glioblastoma -1.400 4.1e-06
medulloblastoma -1.100 4.6e-04
medulloblastoma, large-cell -1.700 3.5e-06
oligodendroglioma -1.400 2.5e-02
osteosarcoma -1.428 4.9e-05
pancreatic ductal adenocarcinoma liver m... -1.581 2.1e-04
psoriasis -2.800 4.6e-05

Gene RIF (262)

AA Sequence

MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLC      1 - 70
GKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPR     71 - 140
TNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGK    141 - 210
ICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK                                       211 - 245
//

Text Mined References (270)

PMID Year Title