Property Summary

NCBI Gene PubMed Count 67
Grant Count 71
R01 Count 55
Funding $6,706,422.91
PubMed Score 256.24
PubTator Score 187.38

Knowledge Summary

Patent (17,609)

Expression

Synonym

Accession P51575 Q9UK84 P2X1
Symbols P2X1

Gene

Gene RIF (54)

PMID Text
25031337 Infection of CD4+ T cells with HIV-1 in the presence of inhibitors of P2X receptors greatly inhibits HIV-1 infection via both cell-free and cell-to-cell contact in a dose-dependent manner, suggesting P2X receptors interact with gp120/gp41 in viral entry
25031337 Infection of CD4+ T cells with HIV-1 in the presence of inhibitors of P2X receptors greatly inhibits HIV-1 infection via both cell-free and cell-to-cell contact in a dose-dependent manner, suggesting P2X receptors interact with gp120/gp41 in viral entry
24845338 These data suggest that vascular smooth muscle cells from human gastro-omental arteries express P2X1 and P2X4 receptor subunits
24661878 With the development of leukemia, the expression of P2X7R increased in both bone marrow and spleen macrophages whereas expression of P2X1 Receptor increased in spleen macrophages.
24633352 enhances platelet activation evoked by mild stimulants via the p38 signalling pathway
23975903 Increased P2X1 receptor expression and ATP release may have contributed to the augmentation of contractile response induced by hypoxia-glucopenia and reoxygenation in he detrusor muscles.
23959888 Data indicate that MgATP2- activates P2X1 and P2X3, but not P2X2 and P2X4 receptors.
23873636 In conclusion, our results demonstrate for the first time that adenine nucleotides acting at P2X1 receptors inhibit the proliferation of human coronary smooth muscle cells via the induction of the early gene NR4A1.
23740251 the contribution of the extracellular, transmembrane, and intracellular segments to recovery from desensitization
22971236 These results suggest that conformational change in the P2X1 receptor is required for co-ordination of ATP action.
More...

AA Sequence

MARRFQEELAAFLFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFLYEKGYQTSSGLISSVSVKLK      1 - 70
GLAVTQLPGLGPQVWDVADYVFPAQGDNSFVVMTNFIVTPKQTQGYCAEHPEGGICKEDSGCTPGKAKRK     71 - 140
AQGIRTGKCVAFNDTVKTCEIFGWCPVEVDDDIPRPALLREAENFTLFIKNSISFPRFKVNRRNLVEEVN    141 - 210
AAHMKTCLFHKTLHPLCPVFQLGYVVQESGQNFSTLAEKGGVVGITIDWHCDLDWHVRHCRPIYEFHGLY    211 - 280
EEKNLSPGFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCD    281 - 350
LLLLHILPKRHYYKQKKFKYAEDMGPGAAERDLAATSSTLGLQENMRTS                         351 - 399
//

Text Mined References (67)

PMID Year Title
24845338 2014 Vascular smooth muscle cells from small human omental arteries express P2X1 and P2X4 receptor subunits.
24661878 2014 Functional expression of P2X family receptors in macrophages is affected by microenvironment in mouse T cell acute lymphoblastic leukemia.
24633352 2014 P2X1-initiated p38 signalling enhances thromboxane A2-induced platelet secretion and aggregation.
23975903 2013 Enhanced purinergic contractile responses and P2X1 receptor expression in detrusor muscle during cycles of hypoxia-glucopenia and reoxygenation.
23959888 2013 Subtype-specific control of P2X receptor channel signaling by ATP and Mg2+.
23873636 2013 P2X1 receptor-mediated inhibition of the proliferation of human coronary smooth muscle cells involving the transcription factor NR4A1.
23740251 2013 P2X receptor chimeras highlight roles of the amino terminus to partial agonist efficacy, the carboxyl terminus to recovery from desensitization, and independent regulation of channel transitions.
22971236 2012 Mass spectrometry analysis of human P2X1 receptors; insight into phosphorylation, modelling and conformational changes.
22851178 2012 Heat shock protein 90 inhibitors reduce trafficking of ATP-gated P2X1 receptors and human platelet responsiveness.
22393010 2012 Agonist binding evokes extensive conformational changes in the extracellular domain of the ATP-gated human P2X1 receptor ion channel.
More...