Property Summary

NCBI Gene PubMed Count 60
Grant Count 15
R01 Count 12
Funding $1,939,482.58
PubMed Score 53.97
PubTator Score 60.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.685 0.001
diabetes mellitus -1.200 0.005
ovarian cancer 2.400 0.000

Gene RIF (22)

PMID Text
26102500 The C-terminal domain of BAP31 is exposed on the cell surface of human embryonic stem cells.
25854864 Transfected human respiratory syncytial virus SH protein co-localizes with transfected BAP31 in cells, and pulls down endogenous BAP31.
25044748 In the titel.
24898727 These findings provide, for the first time, mechanistic insights into how BAP31 regulates human embryonic stem cell stemness and survival via control of EpCAM expression.
24597975 both BCAP31 and ABCD1 were associated with hepatic cholestasis and death before 1 year. Remarkably, a patient with an isolated deletion at the 3'-end of SLC6A8 had a similar severe phenotype as seen in BCAP31 deficiency
24395279 Hypomethylation in BCAP31 is associated with breast cancer.
24011989 the lack of BAP31 disturbs endoplasmic reticulum (ER) metabolism and impacts the Golgi apparatus, highlighting an important role for BAP31 in ER-to-Golgi crosstalk.
23284715 The yeast two-hybrid screen and the coimmunoprecipitation analysis identify the HIV-1 Nef interacting human protein B-cell receptor-associated protein 31 (BAP31), which co-localizes with Nef mainly along membranes of the nucleus or ER/Golgi structures
22190034 The yeast two-hybrid screen and the coimmunoprecipitation analysis identify the HIV-1 Nef interacting human protein B-cell receptor-associated protein 31 (BAP31), which co-localizes with Nef mainly along membranes of the nucleus or ER/Golgi structures
21947079 BAP31 and BiP are essential for dislocation of SV40 from the endoplasmic reticulum to the cytosol.
More...

AA Sequence

MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREI      1 - 70
RKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQA     71 - 140
ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVL    141 - 210
AMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE                                      211 - 246
//

Text Mined References (64)

PMID Year Title
26102500 2015 Epitope Mapping of Antibodies Suggests the Novel Membrane Topology of B-Cell Receptor Associated Protein 31 on the Cell Surface of Embryonic Stem Cells: The Novel Membrane Topology of BAP31.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25854864 2015 Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein.
25044748 2014 Distal Xq28 microdeletions: clarification of the spectrum of contiguous gene deletions involving ABCD1, BCAP31, and SLC6A8 with a new case and review of the literature.
24898727 2014 B-cell receptor-associated protein 31 regulates human embryonic stem cell adhesion, stemness, and survival via control of epithelial cell adhesion molecule.
24597975 2015 Genotype-phenotype correlation of contiguous gene deletions of SLC6A8, BCAP31 and ABCD1.
24395279 2014 Integrated analysis of high-resolution DNA methylation profiles, gene expression, germline genotypes and clinical end points in breast cancer patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24011989 2013 Mutations in BCAP31 cause a severe X-linked phenotype with deafness, dystonia, and central hypomyelination and disorganize the Golgi apparatus.
23967155 2013 Structural and biophysical characterization of the cytoplasmic domains of human BAP29 and BAP31.
More...