Property Summary

NCBI Gene PubMed Count 65
PubMed Score 57.40
PubTator Score 60.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.200 4.8e-03
Multiple myeloma 1.685 9.3e-04
ovarian cancer 2.400 8.0e-06

Gene RIF (26)

AA Sequence

MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREI      1 - 70
RKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQA     71 - 140
ESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVL    141 - 210
AMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE                                      211 - 246
//

Text Mined References (69)

PMID Year Title