Property Summary

NCBI Gene PubMed Count 20
Grant Count 3
Funding $1,451,324
PubMed Score 10.31
PubTator Score 8.55

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P51571 A8K378 Q53XY1 TRAP-delta
Symbols CDG1Y
TRAPD

Gene

Gene RIF (3)

PMID Text
26264460 We now report eight affected males with either de novo (4) or inherited (4) loss of function mutations in SSR4.
22190034 HIV-1 gp160 is identified to have a physical interaction with signal sequence receptor, delta (SSR4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
15057039 results of this study implicate TRAPD as a candidate gene with potential functions that might be associated with ultraviolet-induced melanomagenesis and metastasis

AA Sequence

MAAMASLGALALLLLSSLSRCSAEACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADV      1 - 70
GGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRG     71 - 140
TWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA                                         141 - 173
//

Text Mined References (25)

PMID Year Title
26264460 2015 Expanding the Molecular and Clinical Phenotype of SSR4-CDG.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24218363 2014 A new congenital disorder of glycosylation caused by a mutation in SSR4, the signal sequence receptor 4 protein of the TRAP complex.
21269460 2011 Initial characterization of the human central proteome.
20598277 2010 Terminal osseous dysplasia is caused by a single recurrent mutation in the FLNA gene.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...