Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.34
PubTator Score 8.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE Iy 1 0.0 0.0
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 54 3.162 1.6

Expression

  Differential Expression (11)

Gene RIF (3)

AA Sequence

MAAMASLGALALLLLSSLSRCSAEACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADV      1 - 70
GGKQFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDISIIPPLFTVSVDHRG     71 - 140
TWNGPWVSTEVLAAAIGLVIYYLAFSAKSHIQA                                         141 - 173
//

Text Mined References (25)

PMID Year Title