Property Summary

NCBI Gene PubMed Count 33
PubMed Score 372.43
PubTator Score 273.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 3.9e-06
pediatric high grade glioma 1.200 8.2e-05
posterior fossa group A ependymoma 1.300 7.7e-08

Gene RIF (22)

AA Sequence

MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKD      1 - 70
GLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLS     71 - 140
SSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSL    141 - 210
VPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARH    211 - 280
VVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGG    281 - 350
CTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL                                351 - 392
//

Text Mined References (38)

PMID Year Title