Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.67
PubTator Score 2.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 6.4e-05
non primary Sjogren syndrome sicca 891 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Zellweger syndrome 37 3.102 1.6
Inguinal hernia 14 3.093 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 4.1e-02
ovarian cancer 1.400 6.4e-05

Protein-protein Interaction (3)

Gene RIF (4)

AA Sequence

MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAKYGGRHTVTMIPGDGIGPELM      1 - 70
LHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLD     71 - 140
LYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQE    141 - 210
SGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIV    211 - 280
NNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRK    281 - 350
AVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA                               351 - 393
//

Text Mined References (21)

PMID Year Title