Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.67
PubTator Score 2.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 0.041
ovarian cancer 1.400 0.000

Synonym

Accession P51553 E9PDD5 Q9BUU5
Symbols H-IDHG

Gene

Gene RIF (4)

PMID Text
25496667 Genome-wide shRNA screening identifies IDH3G, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25496667 Knockdown of IDH3G by shRNA significantly inhibits HIV-1 replication in CD4+ T-cells
17432878 Aspartate-190 is a determinant of IDH gamma subunit affinity for the manganese (MnII) ion, as well as for nicotinamide-adenine dinucleotide (NAD), but is not directly required for the catalytic reaction.
16737955 active sites of the human NAD-IDH are shared between alpha and gamma subunits and between alpha and beta subunits

AA Sequence

MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAKYGGRHTVTMIPGDGIGPELM      1 - 70
LHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLD     71 - 140
LYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQE    141 - 210
SGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIV    211 - 280
NNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRK    281 - 350
AVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA                               351 - 393
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17432878 2007 Role of alpha-Asp181, beta-Asp192, and gamma-Asp190 in the distinctive subunits of human NAD-specific isocitrate dehydrogenase.
16737955 2006 Identification of Mn2+-binding aspartates from alpha, beta, and gamma subunits of human NAD-dependent isocitrate dehydrogenase.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...