Property Summary

Ligand Count 3
NCBI Gene PubMed Count 283
PubMed Score 713.09
PubTator Score 528.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Myocardial Infarction 151 0.0 3.0
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 9.6622306968431E-4

Expression

  Differential Expression (22)

Disease log2 FC p
lung cancer 1.300 9.7e-04
acute quadriplegic myopathy 1.545 2.8e-07
astrocytoma 1.500 8.5e-03
atypical teratoid / rhabdoid tumor 1.500 4.4e-05
colon cancer 1.100 4.4e-02
dermatomyositis 1.300 6.5e-03
diabetes mellitus -1.100 2.9e-03
ductal carcinoma in situ 1.100 5.1e-04
group 3 medulloblastoma 1.500 2.1e-03
invasive ductal carcinoma 1.100 1.1e-02
juvenile dermatomyositis 1.003 7.6e-11
lung adenocarcinoma 1.081 8.2e-05
medulloblastoma, large-cell 2.000 7.9e-05
Multiple myeloma 1.072 2.8e-02
osteosarcoma -1.249 1.0e-02
ovarian cancer 3.500 7.0e-11
pancreatic ductal adenocarcinoma liver m... 1.078 1.6e-02
primitive neuroectodermal tumor 1.100 2.7e-04
progressive supranuclear palsy 1.100 2.3e-02
psoriasis 1.500 3.5e-04
spina bifida -1.015 4.8e-02
Waldenstrons macroglobulinemia 1.093 1.6e-02

Protein-protein Interaction (5)

Gene RIF (207)

AA Sequence

MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMH      1 - 70
QMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPS     71 - 140
SGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPM    141 - 210
PGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGP    211 - 280
PKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQS    281 - 350
RITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEV    351 - 420
VVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYH    421 - 490
RSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEY    491 - 560
VANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTG    561 - 630
TDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSE    631 - 700
VDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYN    701 - 770
NNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAA    771 - 840
RRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLT    841 - 910
GTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRL    911 - 980
KKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPY    981 - 1050
MFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRG   1051 - 1120
FKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRA   1121 - 1190
HRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESR   1191 - 1260
HCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARN   1261 - 1330
PKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEI   1331 - 1400
EEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVI   1401 - 1470
KYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFN   1471 - 1540
LEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLK   1541 - 1610
GGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED                                    1611 - 1647
//

Text Mined References (296)

PMID Year Title