Property Summary

NCBI Gene PubMed Count 249
PubMed Score 662.96
PubTator Score 528.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
juvenile dermatomyositis 1189 7.57547603153519E-11
ovarian cancer 8492 7.90542248284092E-9
acute quadriplegic myopathy 1157 2.84131561952646E-7
group 4 medulloblastoma 1875 9.72830097061791E-6
atypical teratoid / rhabdoid tumor 4369 3.9820878483066E-5
medulloblastoma, large-cell 6234 7.93414180413301E-5
lung adenocarcinoma 2714 8.22362918504348E-5
primitive neuroectodermal tumor 3031 1.1467361006475E-4
psoriasis 6685 1.19649321860337E-4
lung cancer 4473 1.89468920316604E-4
ductal carcinoma in situ 1745 5.10950303203736E-4
diabetes mellitus 1663 0.0029187568726241
colon cancer 1475 0.00532789720842326
astrocytoma 1493 0.00558371429070393
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00619462169152968
dermatomyositis 967 0.00650961399670273
Multiple myeloma 1328 0.00814045276950458
osteosarcoma 7933 0.0104577373575778
invasive ductal carcinoma 2950 0.0107483633186858
Waldenstrons macroglobulinemia 765 0.0156482840026233
progressive supranuclear palsy 674 0.0231702428459669
spina bifida 1064 0.0482084816816309
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0
Myocardial Infarction 126 0.0 2.0
Disease Target Count Z-score Confidence
Intellectual disability 573 4.31 2.2
Disease Target Count
Coffin-Siris syndrome 4 1

Expression

  Differential Expression (22)

Synonym

Accession P51532 B1A8Z4 B1A8Z5 B1A8Z6 B1A8Z7 E9PBR8 O95052 Q9HBD3
Symbols BRG1
CSS4
SNF2
SWI2
MRD16
RTPS2
BAF190
SNF2L4
SNF2LB
hSNF2b
BAF190A

Gene

PDB

2GRC   2H60   3UVD   5DKD   5EA1  

  Ortholog (8)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (178)

PMID Text
26966070 These results suggest that ARPE-19 cells possess an AHR-mediated transcription pathway with different target gene specificity, and that BRG1 is required for AHR-mediated transcription in ARPE-19 cells.
26842758 SMARCA4 is involved in the TOP1 recruitment to general chromatin, which suppresses transcription-associated genomic instability.
26645725 Loss of SMARCA4 expression is sensitive/specific for the diagnosis of small cell carcinoma of ovary, hypercalcemic type.
26642721 tetrandrine may inhibit the growth of Hep-2 cells by decreasing the intracellular concentration of Ca2+ and upregulating the expressions of Brg1 and AHNAK
26582913 Activation of DPF3a upon hypertrophic stimuli in cardiac hypertrophy switches cardiac fetal gene expression from being silenced by HEY to being activated by BRG1.
26571505 the role of SMARCA4 and the two SWI/SNF subunits SMARCD2/BAF60B and DPF2/BAF45D in leukaemia, was investigated.
26564006 our data suggest that concomitant loss of SMARCA2 and SMARCA4 is another hallmark of small cell carcinoma of the ovary, hypercalcemic type-a finding that offers new opportunities for therapeutic interventions.
26551623 this study shows for the first time novel SMARCA4-deficient and SMARCA2-deficient variants in undifferentiated gastrointestinal tract carcinomas
26356327 SMARCA4 loss, either alone or with SMARCA2, is highly sensitive and specific for small cell carcinoma of the ovary, hypercalcaemic type, restoration of either SWI/SNF ATPase can inhibit the growth of SCCOHT cell lines
26344687 Brg1 inhibits proliferation and migration of human aortic smooth muscle cells by directly up-regulating RRAD in aortic dissection.
More...

AA Sequence

MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMH      1 - 70
QMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPS     71 - 140
SGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPM    141 - 210
PGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGP    211 - 280
PKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQS    281 - 350
RITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEV    351 - 420
VVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYH    421 - 490
RSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEY    491 - 560
VANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTG    561 - 630
TDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSE    631 - 700
VDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYN    701 - 770
NNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAA    771 - 840
RRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLT    841 - 910
GTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRL    911 - 980
KKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPY    981 - 1050
MFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRG   1051 - 1120
FKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRA   1121 - 1190
HRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESR   1191 - 1260
HCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARN   1261 - 1330
PKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEI   1331 - 1400
EEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVI   1401 - 1470
KYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFN   1471 - 1540
LEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLK   1541 - 1610
GGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED                                    1611 - 1647
//

Text Mined References (260)

PMID Year Title
26966070 2016 Regulation of aryl hydrocarbon receptor-mediated transcription in human retinal pigmented epithelial cells.
26842758 2016 Chromatin remodeller SMARCA4 recruits topoisomerase 1 and suppresses transcription-associated genomic instability.
26645725 2016 Loss of SMARCA4 Expression Is Both Sensitive and Specific for the Diagnosis of Small Cell Carcinoma of Ovary, Hypercalcemic Type.
26642721 2015 Tetrandrine Inhibits the Intracellular Calcium Ion Level and Upregulates the Expression of Brg1 and AHNAK in Hep-2 Cells.
26582913 2016 Phosphorylation of the chromatin remodeling factor DPF3a induces cardiac hypertrophy through releasing HEY repressors from DNA.
26571505 2015 SWI/SNF Subunits SMARCA4, SMARCD2 and DPF2 Collaborate in MLL-Rearranged Leukaemia Maintenance.
26564006 2016 Concomitant loss of SMARCA2 and SMARCA4 expression in small cell carcinoma of the ovary, hypercalcemic type.
26551623 2016 SWI/SNF Complex-deficient Undifferentiated/Rhabdoid Carcinomas of the Gastrointestinal Tract: A Series of 13 Cases Highlighting Mutually Exclusive Loss of SMARCA4 and SMARCA2 and Frequent Co-inactivation of SMARCB1 and SMARCA2.
26356327 2016 Dual loss of the SWI/SNF complex ATPases SMARCA4/BRG1 and SMARCA2/BRM is highly sensitive and specific for small cell carcinoma of the ovary, hypercalcaemic type.
26344687 2015 Brahma-related gene 1 inhibits proliferation and migration of human aortic smooth muscle cells by directly up-regulating Ras-related associated with diabetes in the pathophysiologic processes of aortic dissection.
More...