Property Summary

Ligand Count 2
NCBI Gene PubMed Count 118
PubMed Score 345.34
PubTator Score 114.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.6
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Intellectual disability 1016 4.52 2.3
Hypotrichosis 47 0.0 4.0
Disease Target Count
Nicolaides-Baraitser Syndrome 2

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical adenoma 1.059 1.1e-02
adult high grade glioma -1.200 3.0e-02
aldosterone-producing adenoma -1.304 1.1e-02
atypical teratoid / rhabdoid tumor -1.200 1.7e-02
Breast cancer -1.200 5.4e-08
dermatomyositis -1.200 4.0e-03
Gaucher disease type 1 -1.400 9.6e-03
glioblastoma -1.200 9.7e-03
group 3 medulloblastoma -1.400 2.6e-02
hereditary spastic paraplegia -1.057 1.1e-02
invasive ductal carcinoma -1.100 1.0e-03
lung cancer -2.100 3.8e-03
medulloblastoma, large-cell -1.300 1.4e-02
Multiple myeloma 1.621 1.3e-03
osteosarcoma 1.131 8.2e-03
ovarian cancer -3.200 8.3e-06
Parkinson's disease -1.100 4.0e-02
primitive neuroectodermal tumor -1.100 1.4e-02
psoriasis -1.100 7.8e-03
Rheumatoid arthritis 1.300 1.3e-02
subependymal giant cell astrocytoma -1.839 1.2e-02
Waldenstrons macroglobulinemia 1.198 4.7e-03

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (74)

AA Sequence

MSTPTDPGAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVSHPMPTMGSTDFPQEGM      1 - 70
HQMHKPIDGIHDKGIVEDIHCGSMKGTGMRPPHPGMGPPQSPMDQHSQGYMSPHPSPLGAPEHVSSPMSG     71 - 140
GGPTPPQMPPSQPGALIPGDPQAMSQPNRGPSPFSPVQLHQLRAQILAYKMLARGQPLPETLQLAVQGKR    141 - 210
TLPGLQQQQQQQQQQQQQQQQQQQQQQQPQQQPPQPQTQQQQQPALVNYNRPSGPGPELSGPSTPQKLPV    211 - 280
PAPGGRPSPAPPAAAQPPAAAVPGPSVPQPAPGQPSPVLQLQQKQSRISPIQKPQGLDPVEILQEREYRL    281 - 350
QARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKR    351 - 420
QTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTERE    421 - 490
QKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWEHKQAQAAKEKKKRR    491 - 560
RRKKKAEENAEGGESALGPDGEPIDESSQMSDLPVKVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVA    561 - 630
PRSDSEESDSDYEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQS    631 - 700
YYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHK    701 - 770
RLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHIL    771 - 840
AKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFE    841 - 910
QWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRH    911 - 980
MQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASG    981 - 1050
KFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYF   1051 - 1120
IFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKY   1121 - 1190
KLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDR   1191 - 1260
RREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLRAIE   1261 - 1330
DGNLEEMEEEVRLKKRKRRRNVDKDPAKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDR   1331 - 1400
CNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKD   1401 - 1470
VMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNEEEEEEDEEESESEAKSVKVKIK   1471 - 1540
LNKKDDKGRDKGKGKKRPNRGKAKPVVSDFDSDEEQDEREQSEGSGTDDE                       1541 - 1590
//

Text Mined References (132)

PMID Year Title