Property Summary

NCBI Gene PubMed Count 107
Grant Count 173
R01 Count 92
Funding $23,988,464.75
PubMed Score 331.13
PubTator Score 114.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.013
Waldenstrons macroglobulinemia 1.198 0.005
Multiple myeloma 1.621 0.001
psoriasis -2.000 0.000
osteosarcoma 1.131 0.008
atypical teratoid / rhabdoid tumor -1.200 0.017
glioblastoma -1.200 0.010
medulloblastoma, large-cell -1.300 0.014
primitive neuroectodermal tumor -1.100 0.014
hereditary spastic paraplegia -1.057 0.011
adrenocortical adenoma 1.059 0.011
lung cancer -3.400 0.000
Parkinson's disease -1.100 0.040
adult high grade glioma -1.200 0.030
group 3 medulloblastoma -1.400 0.026
aldosterone-producing adenoma -1.304 0.011
subependymal giant cell astrocytoma -1.839 0.012
Breast cancer -1.300 0.000
invasive ductal carcinoma -1.100 0.001
ovarian cancer -3.200 0.000
Gaucher disease type 1 -1.400 0.010
dermatomyositis -1.200 0.004

Synonym

Accession P51531 B1ALG3 B1ALG4 D3DRH4 D3DRH5
Symbols BRM
SNF2
SWI2
hBRM
NCBRS
Sth1p
BAF190
SNF2L2
SNF2LA
hSNF2a

Gene

PDB

2DAT   4QY4   5DKC   5DKH  

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
652017 screening 3838 / 0 / 365407 Luminescence-based cell-based primary high throughput screening assay to identify activators of the function of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2, BRM)
652022 summary 0 / 0 / 0 Summary of the probe development effort to identify activators of the function of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2, BRM)
652260 screening 1034 / 0 / 2465 Luminescence-based cell-based primary high throughput confirmation assay to identify activators of the function of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2, BRM)
686991 confirmatory 14 / 0 / 214 Luminescence-based cell-based high throughput dose response assay to identify activators of the function of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2, BRM)
720660 confirmatory 0 / 0 / 7 Luminescence-based cell-based late stage dose response assay to identify activators of the function of SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 (SMARCA2, BRM)

Gene RIF (66)

PMID Text
26564006 our data suggest that concomitant loss of SMARCA2 and SMARCA4 is another hallmark of small cell carcinoma of the ovary, hypercalcemic type-a finding that offers new opportunities for therapeutic interventions.
26551623 this study shows for the first time novel SMARCA4-deficient and SMARCA2-deficient variants in undifferentiated gastrointestinal tract carcinomas
26356327 SMARCA4 loss, either alone or with SMARCA2, is highly sensitive and specific for small cell carcinoma of the ovary, hypercalcaemic type, restoration of either SWI/SNF ATPase can inhibit the growth of SCCOHT cell lines
25808524 Knockout of BRG1 or BRM using CRISPR/Cas9 technology resulted in the loss of viability, consistent with a requirement for both enzymes in triple negative breast cancer cells
25731772 Brm-type SWI/SNF chromatin remodeling complex is required for the occasional transcriptional elongation of the HIV-1 provirus in the absence of Tat and for the reactivation of proviral expression from HIV-1 latently infected cells
25731772 Brm-type SWI/SNF chromatin remodeling complex is required for the occasional transcriptional elongation of the HIV-1 provirus in the absence of Tat and for the reactivation of proviral expression from HIV-1 latently infected cells
25673149 The miR-199a/Brm/EGR1 axis is a determinant of anchorage-independent growth in epithelial tumor cell lines
25496315 We report, for the first time, co-inactivation and frequent mutations of SMARCB1, SMARCA2 and PBRM1 in MRTs.
25169058 Phenotype and genotype in Nicolaides-Baraitser syndrome patients with SMARCA2 mutations
25081545 BAF complex gene SMARCA2 is mutated in Coffin-Siris syndrome patients.
More...

AA Sequence

MSTPTDPGAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVSHPMPTMGSTDFPQEGM      1 - 70
HQMHKPIDGIHDKGIVEDIHCGSMKGTGMRPPHPGMGPPQSPMDQHSQGYMSPHPSPLGAPEHVSSPMSG     71 - 140
GGPTPPQMPPSQPGALIPGDPQAMSQPNRGPSPFSPVQLHQLRAQILAYKMLARGQPLPETLQLAVQGKR    141 - 210
TLPGLQQQQQQQQQQQQQQQQQQQQQQQPQQQPPQPQTQQQQQPALVNYNRPSGPGPELSGPSTPQKLPV    211 - 280
PAPGGRPSPAPPAAAQPPAAAVPGPSVPQPAPGQPSPVLQLQQKQSRISPIQKPQGLDPVEILQEREYRL    281 - 350
QARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKR    351 - 420
QTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAVATWHANTERE    421 - 490
QKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANLTNLVWEHKQAQAAKEKKKRR    491 - 560
RRKKKAEENAEGGESALGPDGEPIDESSQMSDLPVKVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVA    561 - 630
PRSDSEESDSDYEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQS    631 - 700
YYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHK    701 - 770
RLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHIL    771 - 840
AKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFE    841 - 910
QWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRH    911 - 980
MQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASG    981 - 1050
KFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYF   1051 - 1120
IFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKY   1121 - 1190
KLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDR   1191 - 1260
RREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDALTEKQWLRAIE   1261 - 1330
DGNLEEMEEEVRLKKRKRRRNVDKDPAKEDVEKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDR   1331 - 1400
CNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKD   1401 - 1470
VMLLCHNAQTFNLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNEEEEEEDEEESESEAKSVKVKIK   1471 - 1540
LNKKDDKGRDKGKGKKRPNRGKAKPVVSDFDSDEEQDEREQSEGSGTDDE                       1541 - 1590
//

Text Mined References (118)

PMID Year Title
26564006 2016 Concomitant loss of SMARCA2 and SMARCA4 expression in small cell carcinoma of the ovary, hypercalcemic type.
26551623 2016 SWI/SNF Complex-deficient Undifferentiated/Rhabdoid Carcinomas of the Gastrointestinal Tract: A Series of 13 Cases Highlighting Mutually Exclusive Loss of SMARCA4 and SMARCA2 and Frequent Co-inactivation of SMARCB1 and SMARCA2.
26356327 2016 Dual loss of the SWI/SNF complex ATPases SMARCA4/BRG1 and SMARCA2/BRM is highly sensitive and specific for small cell carcinoma of the ovary, hypercalcaemic type.
25808524 2015 The SWI/SNF ATPases Are Required for Triple Negative Breast Cancer Cell Proliferation.
25673149 2015 The miR-199a/Brm/EGR1 axis is a determinant of anchorage-independent growth in epithelial tumor cell lines.
25496315 2015 Frequent co-inactivation of the SWI/SNF subunits SMARCB1, SMARCA2 and PBRM1 in malignant rhabdoid tumours.
25416956 2014 A proteome-scale map of the human interactome network.
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
25169058 2014 Phenotype and genotype in Nicolaides-Baraitser syndrome.
25081545 2014 Numerous BAF complex genes are mutated in Coffin-Siris syndrome.
More...