Property Summary

NCBI Gene PubMed Count 27
Grant Count 83
R01 Count 56
Funding $7,369,947.6
PubMed Score 239.30
PubTator Score 165.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.000 0.000
group 3 medulloblastoma 1.400 0.009
medulloblastoma, large-cell 1.200 0.001
primitive neuroectodermal tumor 1.100 0.004
lung cancer 1.500 0.000
colon cancer 1.100 0.029
nasopharyngeal carcinoma 1.500 0.000
non-small cell lung carcinoma 1.100 0.000
Breast cancer 1.600 0.000
ovarian cancer 1.300 0.000
psoriasis 1.200 0.000

Synonym

Accession P51530 Q2NKM1 Q5TC49 Q5TC50 Q6P455 Q6PI80 Q7Z6H9 Q8N346 hDNA2
Symbols DNA2L
hDNA2

Gene

PDB

5EAY  

Gene RIF (19)

PMID Text
25909997 BRCA1 and CtIP contribute to DSB resection by recruiting Dna2 to damage sites, thus ensuring the robust DSB resection necessary for efficient homologous recombination.
25733713 EXO1, MRE11, and CtIP are not involved in the same mechanism of reversed fork processing, whereas human RECQ1 limits DNA2 activity by preventing extensive nascent strand degradation.
25238049 depletion of DNA2 in cells reduces proliferation, addition of estrogen restores proliferation. cells responding to estrogen will proliferate despite impaired in DNA2 activity, potentially promoting genomic instability and triggering cancer development.
25200081 DNA2 stimulates the helicase activity of BLM.
25122754 WRN and BLM act epistatically with DNA2 to promote the long-range resection of double strand break ends in human cells.
24626199 The suppression of FANCD2(-/-) by DNA2 knockdowns suggests that DNA2 and FANCD2 also have antagonistic roles: in the absence of FANCD2, DNA2 somehow corrupts repair.
23352259 These results implicate human DNA2 and the long-patch base-excision repair pathway in the pathogenesis of adult-onset disorders of mtDNA maintenance.
22987153 DNA2 interacts with FANCD2, and cisplatin induces FANCD2 ubiquitylation even in the absence of DNA2.
22570476 analysis of Okazaki fragment processing-independent role for human Dna2 enzyme during DNA replication
22570407 A characterization of the substrate specificities influencing hDna2 binding and cleavage functions and the sequential interaction of hFEN1 and hDna2 on Okazaki fragment intermediates.
More...

AA Sequence

MEQLNELELLMEKSFWEEAELPAELFQKKVVASFPRTVLSTGMDNRYLVLAVNTVQNKEGNCEKRLVITA      1 - 70
SQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILYPDMLISGTSIASSIRCMRRA     71 - 140
VLSETFRSSDPATRQMLIGTVLHEVFQKAINNSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEV    141 - 210
EDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTV    211 - 280
GVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRADPEAGLLLYLKTGQMYPVPANHLD    281 - 350
KRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNCALYSRAVEQQMDCSSVPI    351 - 420
VMLPKIEEETQHLKQTHLEYFSLWCLMLTLESQSKDNKKNHQNIWLMPASEMEKSGSCIGNLIRMEHVKI    421 - 490
VCDGQYLHNFQCKHGAIPVTNLMAGDRVIVSGEERSLFALSRGYVKEINMTTVTCLLDRNLSVLPESTLF    491 - 560
RLDQEEKNCDIDTPLGNLSKLMENTFVSKKLRDLIIDFREPQFISYLSSVLPHDAKDTVACILKGLNKPQ    561 - 630
RQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLG    631 - 700
QIQKVHPAIQQFTEQEICRSKSIKSLALLEELYNSQLIVATTCMGINHPIFSRKIFDFCIVDEASQISQP    701 - 770
ICLGPLFFSRRFVLVGDHQQLPPLVLNREARALGMSESLFKRLEQNKSAVVQLTVQYRMNSKIMSLSNKL    771 - 840
TYEGKLECGSDKVANAVINLRHFKDVKLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGG    841 - 910
VSNVTEAKLIVFLTSIFVKAGCSPSDIGIIAPYRQQLKIINDLLARSIGMVEVNTVDKYQGRDKSIVLVS    911 - 980
FVRSNKDGTVGELLKDWRRLNVAITRAKHKLILLGCVPSLNCYPPLEKLLNHLNSEKLIIDLPSREHESL    981 - 1050
CHILGDFQRE                                                               1051 - 1060
//

Text Mined References (29)

PMID Year Title
25909997 2015 BRCA1 and CtIP Are Both Required to Recruit Dna2 at Double-Strand Breaks in Homologous Recombination.
25733713 2015 DNA2 drives processing and restart of reversed replication forks in human cells.
25238049 2014 The DNA2 nuclease/helicase is an estrogen-dependent gene mutated in breast and ovarian cancers.
25200081 2014 Multifaceted role of the Topo III?-RMI1-RMI2 complex and DNA2 in the BLM-dependent pathway of DNA break end resection.
25122754 2014 DNA2 cooperates with the WRN and BLM RecQ helicases to mediate long-range DNA end resection in human cells.
24626199 2014 Preventing over-resection by DNA2 helicase/nuclease suppresses repair defects in Fanconi anemia cells.
24389050 2014 Genomic analysis of primordial dwarfism reveals novel disease genes.
23604072 2013 Mammalian DNA2 helicase/nuclease cleaves G-quadruplex DNA and is required for telomere integrity.
23352259 2013 Mutations in DNA2 link progressive myopathy to mitochondrial DNA instability.
22987153 2012 DNA2 and EXO1 in replication-coupled, homology-directed repair and in the interplay between HDR and the FA/BRCA network.
More...