Property Summary

NCBI Gene PubMed Count 31
PubMed Score 256.06
PubTator Score 165.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Werner syndrome 29 3.652 1.8
Fanconi anemia 56 3.496 1.7
Seckel syndrome 34 3.48 1.7

Expression

  Differential Expression (11)

Disease log2 FC p
Breast cancer 1.600 1.6e-16
colon cancer 1.100 2.9e-02
group 3 medulloblastoma 1.400 8.7e-03
lung cancer 1.100 2.5e-03
malignant mesothelioma 2.000 2.4e-06
medulloblastoma, large-cell 1.200 1.1e-03
nasopharyngeal carcinoma 1.500 1.5e-06
non-small cell lung carcinoma 1.100 1.1e-19
ovarian cancer 1.300 4.0e-04
primitive neuroectodermal tumor 1.100 3.7e-03
psoriasis 1.200 3.6e-49

Gene RIF (22)

AA Sequence

MEQLNELELLMEKSFWEEAELPAELFQKKVVASFPRTVLSTGMDNRYLVLAVNTVQNKEGNCEKRLVITA      1 - 70
SQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILYPDMLISGTSIASSIRCMRRA     71 - 140
VLSETFRSSDPATRQMLIGTVLHEVFQKAINNSFAPEKLQELAFQTIQEIRHLKEMYRLNLSQDEIKQEV    141 - 210
EDYLPSFCKWAGDFMHKNTSTDFPQMQLSLPSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTV    211 - 280
GVKIHRGYKTKYKIMPLELKTGKESNSIEHRSQVVLYTLLSQERRADPEAGLLLYLKTGQMYPVPANHLD    281 - 350
KRELLKLRNQMAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNCALYSRAVEQQMDCSSVPI    351 - 420
VMLPKIEEETQHLKQTHLEYFSLWCLMLTLESQSKDNKKNHQNIWLMPASEMEKSGSCIGNLIRMEHVKI    421 - 490
VCDGQYLHNFQCKHGAIPVTNLMAGDRVIVSGEERSLFALSRGYVKEINMTTVTCLLDRNLSVLPESTLF    491 - 560
RLDQEEKNCDIDTPLGNLSKLMENTFVSKKLRDLIIDFREPQFISYLSSVLPHDAKDTVACILKGLNKPQ    561 - 630
RQAMKKVLLSKDYTLIVGMPGTGKTTTICTLVRILYACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLG    631 - 700
QIQKVHPAIQQFTEQEICRSKSIKSLALLEELYNSQLIVATTCMGINHPIFSRKIFDFCIVDEASQISQP    701 - 770
ICLGPLFFSRRFVLVGDHQQLPPLVLNREARALGMSESLFKRLEQNKSAVVQLTVQYRMNSKIMSLSNKL    771 - 840
TYEGKLECGSDKVANAVINLRHFKDVKLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGG    841 - 910
VSNVTEAKLIVFLTSIFVKAGCSPSDIGIIAPYRQQLKIINDLLARSIGMVEVNTVDKYQGRDKSIVLVS    911 - 980
FVRSNKDGTVGELLKDWRRLNVAITRAKHKLILLGCVPSLNCYPPLEKLLNHLNSEKLIIDLPSREHESL    981 - 1050
CHILGDFQRE                                                               1051 - 1060
//

Text Mined References (33)

PMID Year Title