Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.24
PubTator Score 5.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 2.9e-07
colon cancer 2.200 5.2e-03
gastric cancer 1.100 2.1e-03
glioblastoma 1.100 1.5e-04
group 3 medulloblastoma 2.000 9.2e-07
lung cancer 1.500 3.6e-03
nasopharyngeal carcinoma 1.200 1.8e-04
ovarian cancer -1.200 3.7e-03
primitive neuroectodermal tumor 1.300 9.7e-04
psoriasis -1.700 2.3e-04

Gene RIF (1)

AA Sequence

MTMLQESFSFDDLSVDFTQKEWQLLDPSQKNLYKDVMLENYSSLVSLGYEVMKPDVIFKLEQGEEPWVGD      1 - 70
GEIPSSDSPEVWKVDGNMMWHQDNQDKLKIIKRGHECDAFGKNFNLNMNFVPLRKSNSEGDLDGLILKHH     71 - 140
LDLLIPKGDYGKAESDDFNVFDNFFLHSKPEDTDTWLKYYDCDKYKESYKKSQIIIYHRNRLGEKLYECS    141 - 210
ECRKRFSKKPSLIKHQSRHIRDIAFGCGNCGKTFPQKSQFITHHRTHTGEKPYNCSQCGKAFSQKSQLTS    211 - 280
HQRTHTGEKPYECGECGKAFSRKSHLISHWRTHTGEKPYGCNECGRAFSEKSNLINHQRIHTGEKPFECR    281 - 350
ECGKAFSRKSQLVTHHRTHTGTKPFGCSDCRKAFFEKSELIRHQTIHTGEKPYECSECRKAFRERSSLIN    351 - 420
HQRTHTGEKPHGCIQCGKAFSQKSHLISHQMTHTGEKPFICSKCGKAFSRKSQLVRHQRTHTGEKPYECS    421 - 490
ECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSHLISHQRTHTGEKPYECSECGKAFGEKSSLAT    491 - 560
HQRTHTGEKPYECRDCEKAFSQKSQLNTHQRIHTGEKPYECSLCRKAFFEKSELIRHLRTHTGEKPYECN    561 - 630
ECRKAFREKSSLINHQRIHTGEKPFECSECGKAFSRKSHLIPHQRTHTGEKPYGCSECRKAFSQKSQLVN    631 - 700
HQRIHTGEKPYRCIECGKAFSQKSQLINHQRTHTVKKS                                    701 - 738
//

Text Mined References (11)

PMID Year Title