Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.17
PubTator Score 5.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.100 0.002
psoriasis -1.700 0.000
glioblastoma 1.100 0.000
group 3 medulloblastoma 2.000 0.000
atypical teratoid/rhabdoid tumor 1.700 0.000
primitive neuroectodermal tumor 1.300 0.001
colon cancer 2.200 0.005
lung cancer 2.000 0.000
nasopharyngeal carcinoma 1.200 0.000
ovarian cancer -1.200 0.004

Gene RIF (1)

PMID Text
11856868 FISH assignment to chromosome 12q24.33; gene organization and splicing

AA Sequence

MTMLQESFSFDDLSVDFTQKEWQLLDPSQKNLYKDVMLENYSSLVSLGYEVMKPDVIFKLEQGEEPWVGD      1 - 70
GEIPSSDSPEVWKVDGNMMWHQDNQDKLKIIKRGHECDAFGKNFNLNMNFVPLRKSNSEGDLDGLILKHH     71 - 140
LDLLIPKGDYGKAESDDFNVFDNFFLHSKPEDTDTWLKYYDCDKYKESYKKSQIIIYHRNRLGEKLYECS    141 - 210
ECRKRFSKKPSLIKHQSRHIRDIAFGCGNCGKTFPQKSQFITHHRTHTGEKPYNCSQCGKAFSQKSQLTS    211 - 280
HQRTHTGEKPYECGECGKAFSRKSHLISHWRTHTGEKPYGCNECGRAFSEKSNLINHQRIHTGEKPFECR    281 - 350
ECGKAFSRKSQLVTHHRTHTGTKPFGCSDCRKAFFEKSELIRHQTIHTGEKPYECSECRKAFRERSSLIN    351 - 420
HQRTHTGEKPHGCIQCGKAFSQKSHLISHQMTHTGEKPFICSKCGKAFSRKSQLVRHQRTHTGEKPYECS    421 - 490
ECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSHLISHQRTHTGEKPYECSECGKAFGEKSSLAT    491 - 560
HQRTHTGEKPYECRDCEKAFSQKSQLNTHQRIHTGEKPYECSLCRKAFFEKSELIRHLRTHTGEKPYECN    561 - 630
ECRKAFREKSSLINHQRIHTGEKPFECSECGKAFSRKSHLIPHQRTHTGEKPYGCSECRKAFSQKSQLVN    631 - 700
HQRIHTGEKPYRCIECGKAFSQKSQLINHQRTHTVKKS                                    701 - 738
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11856868 2001 Assignment to chromosome 12q24.33, gene organization and splicing of the human KRAB/FPB containing zinc finger gene ZNF84.
2505992 The human genome contains hundreds of genes coding for finger proteins of the Krüppel type.
1945843 1991 Members of the zinc finger protein gene family sharing a conserved N-terminal module.