Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.17
PubTator Score 5.15

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
atypical teratoid/rhabdoid tumor 1095 1.3081123008395E-9
group 3 medulloblastoma 2254 9.19894067429485E-7
lung cancer 4473 3.06798580717565E-5
glioblastoma 5572 1.49959335394477E-4
nasopharyngeal carcinoma 1056 1.76600618934454E-4
psoriasis 6685 2.28212284370753E-4
primitive neuroectodermal tumor 3031 9.6905304052772E-4
gastric cancer 436 0.0021469556436849
ovarian cancer 8492 0.00366518595703015
colon cancer 1475 0.00518078005644674


  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.100 0.002
psoriasis -1.700 0.000
glioblastoma 1.100 0.000
group 3 medulloblastoma 2.000 0.000
atypical teratoid/rhabdoid tumor 1.700 0.000
primitive neuroectodermal tumor 1.300 0.001
colon cancer 2.200 0.005
lung cancer 2.000 0.000
nasopharyngeal carcinoma 1.200 0.000
ovarian cancer -1.200 0.004



  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

11856868 FISH assignment to chromosome 12q24.33; gene organization and splicing

AA Sequence

HQRIHTGEKPYRCIECGKAFSQKSQLINHQRTHTVKKS                                    701 - 738

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11856868 2001 Assignment to chromosome 12q24.33, gene organization and splicing of the human KRAB/FPB containing zinc finger gene ZNF84.
2505992 The human genome contains hundreds of genes coding for finger proteins of the Krüppel type.
1945843 1991 Members of the zinc finger protein gene family sharing a conserved N-terminal module.