Property Summary

NCBI Gene PubMed Count 29
PubMed Score 51.75
PubTator Score 38.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.200 1.7e-03
astrocytic glioma 1.100 2.3e-02
Astrocytoma, Pilocytic 1.700 6.6e-08
Atopic dermatitis -1.300 1.9e-03
Breast cancer -2.400 2.5e-02
breast carcinoma -1.100 5.1e-05
colon cancer -2.300 1.4e-02
cystic fibrosis 2.940 2.1e-07
ductal carcinoma in situ -2.400 5.9e-04
glioblastoma 1.300 6.1e-04
group 3 medulloblastoma -1.100 6.8e-03
invasive ductal carcinoma -2.303 2.7e-06
lung cancer 1.900 2.4e-02
lung carcinoma 3.100 1.3e-42
malignant mesothelioma -1.500 5.7e-06
medulloblastoma, large-cell -1.500 1.3e-04
non primary Sjogren syndrome sicca -1.100 2.6e-02
oligodendroglioma 1.200 1.5e-09
psoriasis -1.300 4.9e-06
subependymal giant cell astrocytoma -1.811 1.7e-02

Gene RIF (13)

AA Sequence

MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQ      1 - 70
TIVQLQKETGATIKLSKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQ     71 - 140
PQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQL    141 - 210
SQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAE    211 - 280
VLPTAAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAA    281 - 350
AAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKST    351 - 420
DGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYL    421 - 490
ITQRITYEQGVRAANPQKVG                                                      491 - 510
//

Text Mined References (33)

PMID Year Title