Property Summary

NCBI Gene PubMed Count 25
Grant Count 19
R01 Count 3
Funding $1,756,735.5
PubMed Score 45.95
PubTator Score 38.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
astrocytic glioma 1.100 0.023
psoriasis -1.300 0.000
oligodendroglioma 1.200 0.000
glioblastoma 1.700 0.008
cystic fibrosis 2.940 0.000
medulloblastoma, large-cell -1.500 0.000
Atopic dermatitis -1.300 0.002
colon cancer -2.300 0.014
lung cancer 1.900 0.024
breast carcinoma -1.100 0.000
Breast cancer -2.400 0.025
pediatric high grade glioma 1.800 0.000
group 3 medulloblastoma -1.100 0.007
pilocytic astrocytoma 1.700 0.000
non primary Sjogren syndrome sicca -1.100 0.026
subependymal giant cell astrocytoma -1.811 0.017
invasive ductal carcinoma -2.800 0.010
lung carcinoma 3.100 0.000
ductal carcinoma in situ -2.400 0.001

Gene RIF (9)

PMID Text
26391641 Data indicate RNA binding protein NOVA1 as a target of microRNA miR-339.
26108672 Quantitative proteomic analysis was performed to help elucidate a molecular distinction between glioblastoma and oligodendroglioma; analysis showed HSPB1 and NOVA1 to be discriminating factors.
25299073 MiR-181b-5p is a tumor suppressor in astrocytoma that inhibits tumor progression by targeting NOVA1.
24608171 High expression of NOVA1 correlates with poor prognosis in hepatocellular carcinoma.
24312278 a regulation of LEDGF interaction with chromatin by cellular partners of its PWWP domain could be involved in several processes linked to LEDGF tethering properties, such as lentiviral integration, DNA repair or transcriptional regulation
19680635 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
18822086 Semiquantitative estimation of circulating anti-Ri antibodies demonstrated a renewed increase in antibody levels preceding relapse of the cancer, as confirmed using F-fluorodeoxyglucose positron emission tomography (FDG-PET)
18218628 Gene silencing and overexpression of the nELAV member HuD in motoneuronal NSC34 cells indicate that Nova1 mRNA stability and translation are positively and strongly controlled by the nELAV proteins

AA Sequence

MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQ      1 - 70
TIVQLQKETGATIKLSKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQ     71 - 140
PQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQL    141 - 210
SQKPDGINLQERVVTVSGEPEQNRKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAE    211 - 280
VLPTAAAAAGLLGHANLAGVAAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAA    281 - 350
AAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKST    351 - 420
DGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGTPAATQAAQYL    421 - 490
ITQRITYEQGVRAANPQKVG                                                      491 - 510
//

Text Mined References (29)

PMID Year Title
26391641 2015 MicroRNA-339, an epigenetic modulating target is involved in human gastric carcinogenesis through targeting NOVA1.
26108672 2015 Quantitative proteomic analysis shows differentially expressed HSPB1 in glioblastoma as a discriminating short from long survival factor and NOVA1 as a differentiation factor between low-grade astrocytoma and oligodendroglioma.
25407941 2014 GWAS identifies four novel eosinophilic esophagitis loci.
25299073 2014 MiR-181b-5p downregulates NOVA1 to suppress proliferation, migration and invasion and promote apoptosis in astrocytoma.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24608171 2014 High expression of neuro-oncological ventral antigen 1 correlates with poor prognosis in hepatocellular carcinoma.
24312278 2013 TOX4 and NOVA1 proteins are partners of the LEDGF PWWP domain and affect HIV-1 replication.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19680635 2009 Genome-wide association study of antipsychotic-induced parkinsonism severity among schizophrenia patients.
More...