Property Summary

NCBI Gene PubMed Count 52
Grant Count 22
R01 Count 13
Funding $2,708,509.97
PubMed Score 52.28
PubTator Score 54.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.700 0.009
oligodendroglioma 1.100 0.000
osteosarcoma 2.791 0.004
glioblastoma 1.100 0.037
cystic fibrosis -2.324 0.000
medulloblastoma, large-cell -1.500 0.044
adrenocortical carcinoma 2.056 0.045
adult high grade glioma 1.700 0.004
pilocytic astrocytoma 2.600 0.000
invasive ductal carcinoma -1.651 0.002
lung carcinoma 3.300 0.000
ovarian cancer -1.200 0.000
pituitary cancer 2.200 0.002
facioscapulohumeral dystrophy 2.300 0.003

Gene RIF (27)

PMID Text
26605780 results suggest that miR-145 functions as a tumor metastasis suppressor gene by down-regulating MMP16 and may be a potential target in osteosarcoma treatment
26002729 These results demonstrate that the MT3-MMP promoter is frequently hypermethylated in colorectal cancer and that downregulation of MT3-MMP may be important for cell migration in colorectal cancer.
25808867 MMP16 is a putative indicator of adverse melanoma prognosis.
25017509 Expression of MMP-16 in HTB9 and T24 cells increases following transforming growth factorbeta1 treatment.
24989599 the results support a role for MMP16 in promoting invasive properties of the meningioma tumours
24755270 E2F1 acts as a transcriptional activator for MMPs and directly enhances MMP transcription by binding to E2F1 binding sequences in the promoter, or indirectly activates MMPs (MMP-9 and MMP-16)through enhanced Sp1 and NF-kappa B
23796692 The overexpression of miR-146b-5p in glioblastoma cell lines led to MMP16 mRNA silencing, MMP2 inactivation, and the inhibition of tumour cell migration and invasion.
22348245 Data show that MMP16 is regulated by miR-146a in spontaneously differentiated Caco-2 cells.
22164270 MT3-MMP is a matrix-dependent modifier of the invasive tumor cell functions during melanoma progression
21823013 Matrix metalloproteinase 16 (MMP16) was a downstream target of miR-146b-5p.
More...

AA Sequence

MILLTFSTGRRLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQ      1 - 70
SALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVT     71 - 140
PKVGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAY    141 - 210
FPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPN    211 - 280
DDLQGIQKIYGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTL    281 - 350
AILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQ    351 - 420
PGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGA    421 - 490
FVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTAS    491 - 560
TVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKRSMQEWV                           561 - 607
//

Text Mined References (53)

PMID Year Title
27229514 2016 Biochemical and spectroscopic characterization of the catalytic domain of MMP16 (cdMMP16).
26605780 2015 MicroRNA-145 Suppresses Osteosarcoma Metastasis via Targeting MMP16.
26002729 2015 Promoter hypermethylation of membrane type 3 matrix metalloproteinase is associated with cell migration in colorectal adenocarcinoma.
25808867 2015 MMP16 Mediates a Proteolytic Switch to Promote Cell-Cell Adhesion, Collagen Alignment, and Lymphatic Invasion in Melanoma.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25017509 2014 Transforming growth factor??1 induces epithelial?mesenchymal transition and increased expression of matrix metalloproteinase?16 via miR?200b downregulation in bladder cancer cells.
24989599 2015 A role for matrix remodelling proteins in invasive and malignant meningiomas.
24970228 2014 Prion fragment peptides are digested with membrane type matrix metalloproteinases and acquire enzyme resistance through Cu²?-binding.
24755270 2014 Differential regulation of MMPs by E2F1, Sp1 and NF-kappa B controls the small cell lung cancer invasive phenotype.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
More...