Property Summary

Ligand Count 13
NCBI Gene PubMed Count 34
PubMed Score 43.36
PubTator Score 43.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count
Spontaneous abortion 113
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 1.1
Disease Target Count Z-score Confidence
Cancer 2499 3.418 1.7
Asymptomatic dengue 5 3.253 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 2.6e-05
inflammatory breast cancer 1.200 9.7e-03
malignant mesothelioma -1.200 1.2e-05
osteosarcoma -1.525 3.0e-04

Gene RIF (19)

AA Sequence

MGSDPSAPGRPGWTGSLLGDREEAARPRLLPLLLVLLGCLGLGVAAEDAEVHAENWLRLYGYLPQPSRHM      1 - 70
STMRSAQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRCGVPDQFGVRVKANLRRRRKRYALTGRKWN     71 - 140
NHHLTFSIQNYTEKLGWYHSMEAVRRAFRVWEQATPLVFQEVPYEDIRLRRQKEADIMVLFASGFHGDSS    141 - 210
PFDGTGGFLAHAYFPGPGLGGDTHFDADEPWTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPF    211 - 280
YQWKDVDNFKLPEDDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKP    281 - 350
GPPVQPRATERPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGDIS    351 - 420
AAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFFFQEDRYWRFN    421 - 490
EETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNERLRMEPGYPKSILRDFMGCQ    491 - 560
EHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMVL    561 - 630
VPLLLLLCVLGLTYALVQMQRKGAPRVLLYCKRSLQEWV                                   631 - 669
//

Text Mined References (37)

PMID Year Title