Property Summary

NCBI Gene PubMed Count 33
Grant Count 32
R01 Count 27
Funding $2,996,125.9
PubMed Score 42.28
PubTator Score 43.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
osteosarcoma 1.592 0.000
atypical teratoid / rhabdoid tumor 1.800 0.000
inflammatory breast cancer 1.200 0.010

Gene RIF (18)

PMID Text
25973093 In conclusion, MT2-MMP is involved in gastric cancer invasion and metastasis and may serve as an independent prognostic factor for gastric cancer patients.
25031779 our data suggest that MT2-MMP expression positively involves in non-small cell lung cancer and might play an important role in promoting the tumor progression and intra-tumoral angiogenesis
23228395 HLA-G expression involved in tumor invasiveness or metastasis may rely on the NK cytotoxicity inhibition and induction of MMP-15 expression in ovarian cancer.
22768148 MMP-15 is up-regulated in preeclampsia, but does not cleave endoglin to produce soluble endoglin.
22576687 MMP-15 and MMP-19 are upregulated during colorectal tumorigenesis
21751260 Data show that MT2-MMP was a novel hypoxia-responsive gene and was upregulated by HIF-1alpha under hypoxia.
21036765 The intensity of immunochemical staining of MT2-MMP was significantly positively correlated to the intratumoral angiogenesis of esophageal cancer tissues.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20587546 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGSDPSAPGRPGWTGSLLGDREEAARPRLLPLLLVLLGCLGLGVAAEDAEVHAENWLRLYGYLPQPSRHM      1 - 70
STMRSAQILASALAEMQRFYGIPVTGVLDEETKEWMKRPRCGVPDQFGVRVKANLRRRRKRYALTGRKWN     71 - 140
NHHLTFSIQNYTEKLGWYHSMEAVRRAFRVWEQATPLVFQEVPYEDIRLRRQKEADIMVLFASGFHGDSS    141 - 210
PFDGTGGFLAHAYFPGPGLGGDTHFDADEPWTFSSTDLHGNNLFLVAVHELGHALGLEHSSNPNAIMAPF    211 - 280
YQWKDVDNFKLPEDDLRGIQQLYGTPDGQPQPTQPLPTVTPRRPGRPDHRPPRPPQPPPPGGKPERPPKP    281 - 350
GPPVQPRATERPDQYGPNICDGDFDTVAMLRGEMFVFKGRWFWRVRHNRVLDNYPMPIGHFWRGLPGDIS    351 - 420
AAYERQDGRFVFFKGDRYWLFREANLEPGYPQPLTSYGLGIPYDRIDTAIWWEPTGHTFFFQEDRYWRFN    421 - 490
EETQRGDPGYPKPISVWQGIPASPKGAFLSNDAAYTYFYKGTKYWKFDNERLRMEPGYPKSILRDFMGCQ    491 - 560
EHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMVL    561 - 630
VPLLLLLCVLGLTYALVQMQRKGAPRVLLYCKRSLQEWV                                   631 - 669
//

Text Mined References (36)

PMID Year Title
25973093 2015 Increased MT2-MMP expression in gastric cancer patients is associated with poor prognosis.
25031779 2014 MT2-MMP expression associates with tumor progression and angiogenesis in human lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23228395 2013 Multiple steps of HLA-G in ovarian carcinoma metastasis: alter NK cytotoxicity and induce matrix metalloproteinase-15 (MMP-15) expression.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
22768148 2012 MMP-15 is upregulated in preeclampsia, but does not cleave endoglin to produce soluble endoglin.
22576687 2012 Matrix metalloproteinases 15 and 19 are stromal regulators of colorectal cancer development from the early stages.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21751260 2011 Transcriptional upregulation of MT2-MMP in response to hypoxia is promoted by HIF-1? in cancer cells.
More...