Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.32
PubTator Score 7.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 9.8e-07
ovarian cancer -1.200 5.0e-08

AA Sequence

MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSVGFEVPKPEVI      1 - 70
FKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQRRISGKSTFHSEMEGEDTRDDSLYSILEELWQDAEQIK     71 - 140
RCQEKHNKLLSRTTFLNKKILNTEWDYEYKDFGKFVHPSPNLILSQKRPHKRDSFGKSFKHNLDLHIHNK    141 - 210
SNAAKNLDKTIGHGQVFTQNSSYSHHENTHTGVKFCERNQCGKVLSLKHSLSQNVKFPIGEKANTCTEFG    211 - 280
KIFTQRSHFFAPQKIHTVEKPHELSKCVNVFTQKPLLSIYLRVHRDEKLYICTKCGKAFIQNSELIMHEK    281 - 350
THTREKPYKCNECGKSFFQVSSLLRHQTTHTGEKLFECSECGKGFSLNSALNIHQKIHTGERHHKCSECG    351 - 420
KAFTQKSTLRMHQRIHTGERSYICTQCGQAFIQKAHLIAHQRIHTGEKPYECSDCGKSFPSKSQLQMHKR    421 - 490
IHTGEKPYICTECGKAFTNRSNLNTHQKSHTGEKSYICAECGKAFTDRSNFNKHQTIHTGEKPYVCADCG    491 - 560
RAFIQKSELITHQRIHTTEKPYKCPDCEKSFSKKPHLKVHQRIHTGEKPYICAECGKAFTDRSNFNKHQT    561 - 630
IHTGDKPYKCSDCGKGFTQKSVLSMHRNIHT                                           631 - 661
//

Text Mined References (13)

PMID Year Title