Property Summary

NCBI Gene PubMed Count 101
PubMed Score 280.00
PubTator Score 196.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.271 1.2e-04

Gene RIF (78)

AA Sequence

MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWL      1 - 70
ERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY              71 - 131
//

Text Mined References (102)

PMID Year Title