Property Summary

NCBI Gene PubMed Count 99
Grant Count 31
R01 Count 15
Funding $3,234,641.82
PubMed Score 271.72
PubTator Score 196.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.271 0.000

Gene RIF (76)

PMID Text
26625974 rs6523 polymorphism and AGAG haplotype of INSL3 showed significant association with increased risk of polycystic ovary syndrome.
26579638 Healthy eumenorrheic late adolescent females with sporadic anovulation display higher INSL3 blood concentration.
26077926 hINSL3 seems to recruit Aund spermatogonia into differentiation, potentially mediating an Fsh effect on spermatogenesis.
25728210 Three common INSL3 gene polymorphisms (27G>A, 126G>A, 178G>A) unrelated to any particular phenotype of testicular maldescent (TMD) were detected both in patients and controls, indicating that INSL3 gene mutations are not a common cause of TMD.
25516081 INSL3 in girls is a unique and specific marker of theca cells surrounding antral follicles.
24908673 DLK1, INSL3 and COUP-TFII expression changes during normal development and is linked to different stages of Leydig Cell differentiation.
24659579 low INSL3 concentration is related to the pathogenesis behind an unfavourable change in body composition and bone metabolism among Klinefelter syndrome patients
24640568 The aim of this study was to assess plasma INSL3 in patients with osteoporosis and Klinefelter's Syndrome compared to healthy males.
24243640 INSL3 is as sensitive a marker as T for the evaluation of altered Leydig cell function in congenital hypogonadotropic hypogonadism/Kallmann syndrome patients.
23928669 INSL3 and AMH levels are significantly correlated with each other in women with PCOS, and they are significantly increased, particularly in the presence of amenorrhea and oligomenorrhea.
More...

AA Sequence

MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPATGGDRELLQWL      1 - 70
ERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY              71 - 131
//

Text Mined References (100)

PMID Year Title
26625974 2016 Polymorphisms and haplotypes of insulin-like factor 3 gene are associated with risk of polycystic ovary syndrome in Indian women.
26579638 2015 Anti-müllerian hormone and insulin-like 3 levels in healthy normal-weight ovulatory and anovulatory eumenorrheic late adolescent females: potential early biomarkers of ovarian dysfunction?
26077926 2016 INSL3 stimulates spermatogonial differentiation in testis of adult zebrafish (Danio rerio).
25728210 2014 Genetic analysis of the human Insulin-like 3 gene: absence of mutations in a Greek paediatric cohort with testicular maldescent.
25516081 2015 Longitudinal assessment of circulating insulin-like peptide 3 levels in healthy peripubertal girls.
24908673 2014 Expression patterns of DLK1 and INSL3 identify stages of Leydig cell differentiation during normal development and in testicular pathologies, including testicular cancer and Klinefelter syndrome.
24659579 2014 Low INSL3 in Klinefelter syndrome is related to osteocalcin, testosterone treatment and body composition, as well as measures of the hypothalamic-pituitary-gonadal axis.
24640568 2013 Plasma insulin-like factor 3 (INSL3) in male patients with osteoporosis and Klinefelter's syndrome.
24243640 2014 Insulin-like peptide 3 (INSL3) in men with congenital hypogonadotropic hypogonadism/Kallmann syndrome and effects of different modalities of hormonal treatment: a single-center study of 281 patients.
23928669 2013 Parallel variations of insulin-like peptide 3 (INSL3) and antimüllerian hormone (AMH) in women with the polycystic ovary syndrome according to menstrual cycle pattern.
More...