Property Summary

NCBI Gene PubMed Count 74
Grant Count 32
R01 Count 9
Funding $4,505,007.6
PubMed Score 76.56
PubTator Score 82.13

Knowledge Summary

Patent (12,029)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.613 0.000
interstitial cystitis 2.200 0.005

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (51)

PMID Text
26246128 A major mechanism underlying the BLK association with autoimmune disease involves lowered thresholds for basal B cell receptor signaling, enhanced B cell-T cell interactions, and altered patterns of isotype switching.
25972485 our study reveals a previously unappreciated role of reduced BLK expression on extraperitoneal accumulation of B1a cells in mice, as well as the presence of IgG autoantibodies and B1-like cells in humans.
25926555 Report a novel BLK gene variant in common variable immunodeficiency-patients that causes suppressed B-cell proliferation and reduced ability of B-cells to elicit antigen-specific CD4(+) T-cell responses.
25470816 Results support previous findings that vaiants in the RHOB and FAM167A-BLK genes may be associated with susceptibility to systemic sclerosis.
25025568 These results place Blk upstream of the p190RhoGAP-RhoA pathway in Galpha13-activated cells, overall representing an opposing signaling module during CXCL12-triggered invasion.
24919804 B-lymphoid tyrosine kinase (Blk) is an oncogene and a potential target for therapy with dasatinib in cutaneous T-cell lymphoma
24702955 results demonstrated that both lupus-associated functional variants contribute to the autoimmune disease association by modulating transcription of BLK in B cells and thus potentially altering immune responses
24632671 The observations suggested that C8orf13-BLK, in combination with STAT4, plays a pivotal role in creating genetic susceptibility to polymyositis/dermatomyositis in Japanese individuals.
24091983 Report role of BLK genetic variants in confering risk of systemic lupus erythematosus in Chinese population.
24085759 Our study confirms evidence for epistasis between BLK and BANK1 in systemic lupus erythematosis from a Chinese population for the first time.
More...

AA Sequence

MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYT      1 - 70
AMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWFFRSQGRKEAERQLLA     71 - 140
PINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHYSKKGD    141 - 210
GLCQRLTLPCVRPAPQNPWAQDEWEIPRQSLRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEA    211 - 280
FLGEANVMKALQHERLVRLYAVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY    281 - 350
IERMNSIHRDLRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWS    351 - 420
FGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEERPTFEFLQSVL    421 - 490
EDFYTATERQYELQP                                                           491 - 505
//

Text Mined References (80)

PMID Year Title
26246128 2015 Autoimmune disease-associated haplotypes of BLK exhibit lowered thresholds for B cell activation and expansion of Ig class-switched B cells.
25972485 2015 Concordance of increased B1 cell subset and lupus phenotypes in mice and humans is dependent on BLK expression levels.
25926555 2015 Dysfunctional BLK in common variable immunodeficiency perturbs B-cell proliferation and ability to elicit antigen-specific CD4+ T-cell help.
25470816 2014 Possible single-nucleotide polymorphism loci associated with systemic sclerosis susceptibility: a genetic association study in a Chinese Han population.
25416956 2014 A proteome-scale map of the human interactome network.
25025568 2014 A Blk-p190RhoGAP signaling module downstream of activated G?13 functionally opposes CXCL12-stimulated RhoA activation and cell invasion.
24919804 2014 B-lymphoid tyrosine kinase (Blk) is an oncogene and a potential target for therapy with dasatinib in cutaneous T-cell lymphoma (CTCL).
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24702955 2014 Two functional lupus-associated BLK promoter variants control cell-type- and developmental-stage-specific transcription.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
More...