Property Summary

NCBI Gene PubMed Count 86
Grant Count 58
R01 Count 39
Funding $5,991,745.46
PubMed Score 116.23
PubTator Score 590.61

Knowledge Summary

Patent (8,367)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.400 0.000

Synonym

Accession P51449 Q5SZR9 Q8N5V7 Q8NCY8
Symbols TOR
RORG
RZRG
IMD42
NR1F3
RZR-GAMMA

Gene

PDB

3B0W   3KYT   3L0J   3L0L   4NB6   4NIE   4QM0   4S14   4WLB   4WPF   4WQP   4XT9   4YMQ   4YPQ   4ZJR   4ZJW   4ZOM   5APH   5APJ   5APK   5AYG   5C4O   5C4S   5C4T   5C4U   5EJV   5ETH   5G42   5G43   5G44   5G45   5G46   5IXK   5IZ0  

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
463147 screening 0 / 0 / 6 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescence-based cell-based assay to identify RORG inhibitors
463151 confirmatory 0 / 0 / 1 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptors (RORA): luminescent-based dose response assay to identify RORG inhibitors
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
624276 confirmatory 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): radioligand binding for ROR gamma using Scintillation Proximity Assay (SPA)
624277 other 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): Luminescence-based cell-based assays using RORE-Luc, IL-17-Luc, and ABCA1-Luc Reporters
624279 confirmatory 1 / 0 / 0 Late stage assay provider counterscreen from the probe development effort to identify selective inverse agonists of the Retinoic acid receptor-related Orphan Receptor Gamma (RORC): luminescence-based cell-based dose response panel assay against ROR alpha, ROR gamma, LXR, FXR, and VP16

Gene RIF (68)

PMID Text
27082299 A high copy number of T-bet and GATA-3 confers susceptibility to AAU and AS, and a high copy number of FOXP3 confers susceptibility to female patients with AAU either with or without AS.
26878233 Results reveal differential requirements for ROR-gammat in the maintenance of TH17 cell and group 3 innate lymphoid cell responses in intestinal inflammation.
26640126 Binding at this non-canonical site induces an unprecedented conformational reorientation of helix 12 in the RORgammat ligand binding domain.
26564244 High RORgammaT expression is associated with lymph node metastasis in Colorectal Cancer.
26549310 RORgammat is acetylated, and this acetylation is reciprocally regulated by the histone acetyltransferase p300 and the histone deacetylase HDAC1.
26498317 The findings suggest that RORC plays a significant role in the dysregulated immune response associated with lupus erythematosus (SLE) .
26474968 The mRNA expression of RORC, TNF-alpha and IL-6 was significantly high in CC patients
26453305 findings reveal a direct link between TRAF5-mediated ubiquitination and RORgammat protein regulation
26434354 the balance between the transcription factors of Treg and Th17 cells (FoXp3 and RORgammat) was sought as a molecular marker of disease activity and to highlight the pathogenesis of autoimmune liver diseases
26415373 RORgammat mRNA increased with tumor size and multiple tumor foci in hepatocellular carcinoma
More...

AA Sequence

MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQ      1 - 70
QNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAG     71 - 140
AQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGK    141 - 210
AEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKS    211 - 280
YRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQI    281 - 350
VLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY    351 - 420
TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLH    421 - 490
PIVVQAAFPPLYKELFSTETESPVGLSK                                              491 - 518
//

Text Mined References (92)

PMID Year Title
27082299 2016 Association of T-Bet, GATA-3, RORC, and FOXP3 Copy Number Variations With Acute Anterior Uveitis With or Without Ankylosing Spondylitis in Chinese Han.
26878233 2016 Transient inhibition of ROR-?t therapeutically limits intestinal inflammation by reducing TH17 cells and preserving group 3 innate lymphoid cells.
26640126 2015 Identification of an allosteric binding site for ROR?t inhibition.
26564244 2016 A High ROR?T/CD3 Ratio is a Strong Prognostic Factor for Postoperative Survival in Advanced Colorectal Cancer: Analysis of Helper T Cell Lymphocytes (Th1, Th2, Th17 and Regulatory T Cells).
26549310 2015 Reciprocal regulation of ROR?t acetylation and function by p300 and HDAC1.
26498317 2016 Down-regulation of expression of retinoid acid-related orphan receptor C (RORC) in systemic lupus erythematosus.
26474968 2015 The existence of Th22, pure Th17 and Th1 cells in CIN and Cervical Cancer along with their frequency variation in different stages of cervical cancer.
26453305 2015 TRAF5-mediated Lys-63-linked Polyubiquitination Plays an Essential Role in Positive Regulation of ROR?t in Promoting IL-17A Expression.
26434354 2015 A molecular marker of disease activity in autoimmune liver diseases with histopathological correlation; FoXp3/ROR?t ratio.
26415373 2015 IL-17 Producing Cells and ROR?t mRNA Transcriptional Factor in Cirrhotic and HCC Egyptian Patients.
More...