Property Summary

Ligand Count 273
NCBI Gene PubMed Count 102
PubMed Score 123.24
PubTator Score 590.61

Knowledge Summary

Patent (8,367)

TINX Plot

  Disease (5)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.400 1.5e-166

Protein-protein Interaction (6)

Gene RIF (85)

AA Sequence

MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQ      1 - 70
QNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAG     71 - 140
AQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGK    141 - 210
AEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKS    211 - 280
YRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQI    281 - 350
VLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY    351 - 420
TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLH    421 - 490
PIVVQAAFPPLYKELFSTETESPVGLSK                                              491 - 518
//

Text Mined References (108)

PMID Year Title