Property Summary

NCBI Gene PubMed Count 18
PubMed Score 160.86
PubTator Score 362.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Colitis, Ulcerative 59 0.0 0.0
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
ulcerative colitis 1819 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 4.244 2.1

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 3.5e-06
ependymoma 1.400 2.5e-10
esophageal adenocarcinoma 1.100 1.8e-02
glioblastoma 1.500 3.4e-03
medulloblastoma 1.200 2.4e-06
Multiple myeloma 1.033 1.8e-03
ovarian cancer -1.100 1.9e-03
pituitary cancer -1.200 1.8e-04
subependymal giant cell astrocytoma 1.840 2.3e-02

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDF      1 - 70
PPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK                                           71 - 102
//

Text Mined References (23)

PMID Year Title