Property Summary

NCBI Gene PubMed Count 58
Grant Count 8
R01 Count 2
Funding $1,133,627
PubMed Score 137.54
PubTator Score 116.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
psoriasis 2.200 0.000
posterior fossa group A ependymoma 1.300 0.000
glioblastoma 1.300 0.003
lung cancer -1.300 0.009
interstitial cystitis -1.200 0.000
group 3 medulloblastoma -1.600 0.001
ulcerative colitis -1.600 0.000

Gene RIF (47)

PMID Text
26755577 slow phase of Gi/o-mediated TRPC4 activation was diminished by inhibiting RhoA or enhancing PLCdelta function
25995263 Both unsaturated and saturated dioleoyl-phosphatidylinositol-(4,5)-bisphosphate successfully recruited PHPLCdelta1 to cell membranes.
25655282 Ectopic expression of PLCD1 inhibits breast tumor cell proliferation in vivo by inducing apoptosis and suppressed tumor cell migration by regulating cytoskeletal reorganization.
25477137 PLC-delta1 and TRPV6 are critical actor of Ca(2+) homeostasis in CF human bronchial epithelial cells.
25130443 HIV-1 Gag co-localizes with the PH domain of PLC-delta at the long and thin connections termed tunnelling nanotube tips
24903829 Neuropeptide Y decreased PLCD1 expression in HUVECs.
23948486 PLCdelta1 is required for maintenance of homeostasis in skin and metabolic tissues. [review]
23388389 Provide evidence for intramolecular interactions in the PLC-delta1 PH domain.
23149345 Genotyping using microsatellite markers linked the families to the gene PLCD1 on chromosome 3p22.2. Sequence analysis of the gene detected one novel (p.Ser740ArgfsX19) and one previously reported mutation (p.Arg437X).
22576628 PLCD1 acts as a functional tumor suppressor and may serve as a biomarker for possible early detection and prognosis of chronic myeloid leukemia.
More...

AA Sequence

MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRTPESQLFSIE      1 - 70
DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQHWVLGLHKIIHHSGSMDQRQK     71 - 140
LQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQTDSLEDEEIEAFYKMLTQ    141 - 210
RVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLL    211 - 280
SADGSAFSLAHRRVYQDMGQPLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRCLELDCWDGPNQ    281 - 350
EPIIYHGYTFTSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQQRVMARHLHAILGPMLLNRPLDG    351 - 420
VTNSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDEAVRSRVQHKPKEDKLRLAQ    421 - 490
ELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFVRHNVGHLSRIYPAGWRTDSS    491 - 560
NYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNGTFNPRALAQGPWWARKR    561 - 630
LNIRVISGQQLPKVNKNKNSIVDPKVTVEIHGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALI    631 - 700
RFLVEDYDASSKNDFIGQSTIPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD                  701 - 756
//

Text Mined References (62)

PMID Year Title
26755577 2016 Critical roles of Gi/o proteins and phospholipase C-?1 in the activation of receptor-operated TRPC4 channels.
25995263 2015 Phosphatidylinositol-(4,5)-Bisphosphate Acyl Chains Differentiate Membrane Binding of HIV-1 Gag from That of the Phospholipase C?1 Pleckstrin Homology Domain.
25655282 2015 Methylation of PLCD1 and adenovirus-mediated PLCD1 overexpression elicits a gene therapy effect on human breast cancer.
25477137 2015 The low PLC-?1 expression in cystic fibrosis bronchial epithelial cells induces upregulation of TRPV6 channel activity.
24903829 2014 Neuropeptide Y reduces the expression of PLCB2, PLCD1 and selected PLC genes in cultured human endothelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23948486 2013 Physiological functions of phospholipase C?1 and phospholipase C?3.
23388389 2013 Intramolecular allosteric interaction in the phospholipase C-?1 pleckstrin homology domain.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...