Property Summary

Ligand Count 1
NCBI Gene PubMed Count 63
PubMed Score 140.94
PubTator Score 116.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma 1.100 9.6e-06
glioblastoma 1.300 2.9e-03
group 3 medulloblastoma -1.600 1.1e-03
interstitial cystitis -1.100 4.1e-03
lung cancer -1.300 9.0e-03
malignant mesothelioma -2.000 3.1e-06
psoriasis 2.200 4.9e-05
ulcerative colitis -1.600 5.6e-08

Gene RIF (51)

AA Sequence

MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRTPESQLFSIE      1 - 70
DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQHWVLGLHKIIHHSGSMDQRQK     71 - 140
LQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQTDSLEDEEIEAFYKMLTQ    141 - 210
RVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLL    211 - 280
SADGSAFSLAHRRVYQDMGQPLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRCLELDCWDGPNQ    281 - 350
EPIIYHGYTFTSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQQRVMARHLHAILGPMLLNRPLDG    351 - 420
VTNSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDEAVRSRVQHKPKEDKLRLAQ    421 - 490
ELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFVRHNVGHLSRIYPAGWRTDSS    491 - 560
NYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNGTFNPRALAQGPWWARKR    561 - 630
LNIRVISGQQLPKVNKNKNSIVDPKVTVEIHGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALI    631 - 700
RFLVEDYDASSKNDFIGQSTIPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD                  701 - 756
//

Text Mined References (67)

PMID Year Title