Property Summary

NCBI Gene PubMed Count 34
PubMed Score 14.72
PubTator Score 19.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 4.3e-54
Disease Target Count Z-score Confidence
Liddle syndrome 14 3.224 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.300 4.3e-54

 CSPA Cell Line (1)

Gene RIF (24)

AA Sequence

MAEHRSMDGRMEAATRGGSHLQAAAQTPPRPGPPSAPPPPPKEGHQEGLVELPASFRELLTFFCTNATIH      1 - 70
GAIRLVCSRGNRLKTTSWGLLSLGALVALCWQLGLLFERHWHRPVLMAVSVHSERKLLPLVTLCDGNPRR     71 - 140
PSPVLRHLELLDEFARENIDSLYNVNLSKGRAALSATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLC    141 - 210
NSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWEDSHGSQDGHFVLSCSYDGLDCQARQFRTFHH    211 - 280
PTYGSCYTVDGVWTAQRPGITHGVGLVLRVEQQPHLPLLSTLAGIRVMVHGRNHTPFLGHHSFSVRPGTE    281 - 350
ATISIREDEVHRLGSPYGHCTAGGEGVEVELLHNTSYTRQACLVSCFQQLMVETCSCGYYLHPLPAGAEY    351 - 420
CSSARHPAWGHCFYRLYQDLETHRLPCTSRCPRPCRESAFKLSTGTSRWPSAKSAGWTLATLGEQGLPHQ    421 - 490
SHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGSLCSLWFGASVLSLLELLELLLDASALTLVL    491 - 560
GGRRLRRAWFSWPRASPASGASSIKPEASQMPPPAGGTSDDPEPSGPHLPRVMLPGVLAGVSAEESWAGP    561 - 630
QPLETLDT                                                                  631 - 638
//

Text Mined References (34)

PMID Year Title