Property Summary

NCBI Gene PubMed Count 32
PubMed Score 8.72
PubTator Score 19.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Liddle syndrome 14 3.115 1.6
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.300 0.000

Synonym

Accession P51172 A9Z1X6 B1PS44 Q08AQ3 Q09HT0 Q5T7L3 Q8NA24
Symbols ENaCd
SCNED
dNaCh
ENaCdelta

Gene

PANTHER Protein Class (2)

Gene RIF (22)

PMID Text
25677639 delta-ENaC expression is low in NCI-H441, Calu-3, and ATI cells and does not contribute to transepithelial sodium absorption
22505667 study characterized a new variant, delta2 ENaC, in lung epithelial cells; heterologous delta2betagamma ENaC exhibited a number of divergent features from the delta1betagamma counterpart in biophysics and pharmacology, regulation, and the lifespan of proteins
22159085 delta-ENaC undergoes dynamin-independent endocytosis as opposed to alphabetagamma-channels.
21741370 These results suggest that COMMD1 downregulates deltaENaC activity by reducing deltaENaC surface expression through promoting internalization of surface deltaENaC to an intracellular recycling pool, possibly via enhanced ubiquitination.
21562313 CPT-cGMP Stimulates Human Alveolar Fluid Clearance by Releasing External Na+ Self-Inhibition of ENaC.
21419751 Cpt-cAMP activates human epithelial sodium channels via relieving self-inhibition.
21307123 Identify the specific domains of epithelial sodium channels that are responsible for the differences in the response to flow of alphabetagamma and deltabetagamma channels.
20631247 Data support a physiological role for SGK1.1 in the regulation of delta-ENaC through a pathway that differs from the classical one and suggest that the kinase could serve as an integrator of different signaling pathways converging on the channel.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAEHRSMDGRMEAATRGGSHLQAAAQTPPRPGPPSAPPPPPKEGHQEGLVELPASFRELLTFFCTNATIH      1 - 70
GAIRLVCSRGNRLKTTSWGLLSLGALVALCWQLGLLFERHWHRPVLMAVSVHSERKLLPLVTLCDGNPRR     71 - 140
PSPVLRHLELLDEFARENIDSLYNVNLSKGRAALSATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLC    141 - 210
NSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWEDSHGSQDGHFVLSCSYDGLDCQARQFRTFHH    211 - 280
PTYGSCYTVDGVWTAQRPGITHGVGLVLRVEQQPHLPLLSTLAGIRVMVHGRNHTPFLGHHSFSVRPGTE    281 - 350
ATISIREDEVHRLGSPYGHCTAGGEGVEVELLHNTSYTRQACLVSCFQQLMVETCSCGYYLHPLPAGAEY    351 - 420
CSSARHPAWGHCFYRLYQDLETHRLPCTSRCPRPCRESAFKLSTGTSRWPSAKSAGWTLATLGEQGLPHQ    421 - 490
SHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGSLCSLWFGASVLSLLELLELLLDASALTLVL    491 - 560
GGRRLRRAWFSWPRASPASGASSIKPEASQMPPPAGGTSDDPEPSGPHLPRVMLPGVLAGVSAEESWAGP    561 - 630
QPLETLDT                                                                  631 - 638
//

Text Mined References (32)

PMID Year Title
26772908 2016 Epithelial sodium channel (ENaC) family: Phylogeny, structure-function, tissue distribution, and associated inherited diseases.
25677639 2015 Expression and function of the epithelial sodium channel ?-subunit in human respiratory epithelial cells in vitro.
22505667 2012 Characterization of a novel splice variant of ? ENaC subunit in human lungs.
22159085 2012 Differential N termini in epithelial Na+ channel ?-subunit isoforms modulate channel trafficking to the membrane.
21741370 2011 COMMD1 regulates the delta epithelial sodium channel (?ENaC) through trafficking and ubiquitination.
21562313 2011 8-(4-chlorophenylthio)-guanosine-3',5'-cyclic monophosphate-Na stimulates human alveolar fluid clearance by releasing external Na+ self-inhibition of epithelial Na+ channels.
21419751 2011 Cpt-cAMP activates human epithelial sodium channels via relieving self-inhibition.
21307123 2011 Second transmembrane domain modulates epithelial sodium channel gating in response to shear stress.
20631247 2010 The neuronal-specific SGK1.1 kinase regulates {delta}-epithelial Na+ channel independently of PY motifs and couples it to phospholipase C signaling.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...